Lus10040855 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59910 189 / 2e-62 HTB4 Histone superfamily protein (.1)
AT1G07790 188 / 3e-62 HTB1 Histone superfamily protein (.1)
AT5G02570 186 / 6e-62 Histone superfamily protein (.1)
AT3G45980 187 / 8e-62 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G46030 187 / 8e-62 HTB11 Histone superfamily protein (.1)
AT2G28720 186 / 1e-61 Histone superfamily protein (.1)
AT2G37470 185 / 3e-61 Histone superfamily protein (.1)
AT5G22880 185 / 4e-61 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT3G53650 184 / 5e-61 Histone superfamily protein (.1)
AT3G09480 168 / 8e-55 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017456 190 / 3e-63 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10005897 190 / 6e-63 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10005893 189 / 8e-63 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10023753 188 / 2e-62 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Lus10016156 188 / 3e-62 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10037371 187 / 6e-62 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 187 / 8e-62 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10017292 187 / 9e-62 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 186 / 1e-61 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G231300 191 / 1e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030600 191 / 1e-63 AT5G59910 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230701 190 / 3e-63 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.008G030500 190 / 3e-63 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.008G029900 190 / 4e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030400 190 / 5e-63 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.010G230801 189 / 6e-63 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.010G230600 189 / 6e-63 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.004G091200 189 / 9e-63 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.017G123700 189 / 1e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10040855 pacid=23157784 polypeptide=Lus10040855 locus=Lus10040855.g ID=Lus10040855.BGIv1.0 annot-version=v1.0
ATGGCGCCCAAAGCAGAGAAGAAGCCAGCGGAGAAGAAGCCCGCAGAGGAGAAGAAAACCGTCGCCGAGAAAGCTCCCGCCGAGAAGAAACCCAAGGCCG
GGAAGAAGCTCCCCAAAGAAGCCGGCGCAGCTGCTGCAGGCGACAAGAAGAAGAAGAAGTCAAAGAAGAGCGTCGAGACCTACAAGATCTACATCTTCAA
GGTTCTCAAGCAGGTCCATCCCGATATCGGTATCTCCAGCAAGGCTATGGGGATCATGAACTCCTTCATCAACGACATTTTCGAGAAACTAGCTCAGGAG
TCCTCCAGACTCGCTCGCTACAACAAGAAGCCGACGATTACCTCCAGGGAGATCCAGACTGCCGTCCGATTGGTGCTTCCGGGAGAATTGGCCAAACATG
CCGTGTCTGAAGGGACCAAGGCTGTTACCAAGTTCACCAGCTCTTGA
AA sequence
>Lus10040855 pacid=23157784 polypeptide=Lus10040855 locus=Lus10040855.g ID=Lus10040855.BGIv1.0 annot-version=v1.0
MAPKAEKKPAEKKPAEEKKTVAEKAPAEKKPKAGKKLPKEAGAAAAGDKKKKKSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE
SSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10040855 0 1
AT1G51510 Y14 RNA-binding (RRM/RBD/RNP motif... Lus10009963 1.0 0.9205
AT5G42700 B3 AP2/B3-like transcriptional fa... Lus10019873 2.0 0.8728
AT5G05080 ATUBC22, UBC22 ubiquitin-conjugating enzyme 2... Lus10038982 4.0 0.8627
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10037655 6.0 0.8746
AT1G51060 HTA10 histone H2A 10 (.1) Lus10032464 6.6 0.9020
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10040161 12.0 0.8669
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10004366 17.7 0.8478
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10015637 18.4 0.8377
AT5G02610 Ribosomal L29 family protein ... Lus10025292 18.6 0.8342
AT1G08970 CCAAT NF-YC9, HAP5C "nuclear factor Y, subunit C9"... Lus10021934 21.2 0.8294

Lus10040855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.