Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28710 40 / 2e-05 C2H2ZnF C2H2-type zinc finger family protein (.1) AT3G53600 39 / 3e-05 C2H2ZnF C2H2-type zinc finger family protein (.1) AT2G37430 37 / 0.0002 C2H2ZnF ZAT11 C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G03510 37 / 0.0004 C2H2ZnF C2H2-type zinc finger family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030330 [exp] 39 / 6e-05 AT2G37430 125 / 2e-36 C2H2 and C2HC zinc fingers superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G209400 [exp] 39 / 6e-05 AT2G28710 129 / 2e-38 C2H2-type zinc finger family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040858 pacid=23157945 polypeptide=Lus10040858 locus=Lus10040858.g ID=Lus10040858.BGIv1.0 annot-version=v1.0 ATGGGGCAGGCGCTGGGAGGGCACATGAGGCGCCACCGTGGGTTGAATCCCACGGCGGTTGTGGCGATGAAGAAGTCGGCGGCGGCAGCGTCGAAGGATA AGGCGGAGGTTACGACGTGGGTGGATTTGGATTTGAATTTGACGCCGCTTGAGAATTACGACTTGCGGTTGCAGTTAGGGAACGCCGCCGGCCATATGTA G
AA sequence Show only first row Show all	>Lus10040858 pacid=23157945 polypeptide=Lus10040858 locus=Lus10040858.g ID=Lus10040858.BGIv1.0 annot-version=v1.0 MGQALGGHMRRHRGLNPTAVVAMKKSAAAASKDKAEVTTWVDLDLNLTPLENYDLRLQLGNAAGHM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28710	C2H2ZnF		C2H2-type zinc finger family p...		Lus10040858 [exp]	0	1
AT5G12340			unknown protein		Lus10009698 [exp]	4.2	0.8726
AT1G32100		ATPRR1	pinoresinol reductase 1 (.1)		Lus10012145 [exp]	13.0	0.8399
AT5G08790	NAC	ATAF2, ANAC081	Arabidopsis NAC domain contain...		Lus10020883 [exp]	14.5	0.8879
AT3G02875		ILR1	IAA-LEUCINE RESISTANT 1, Pepti...		Lus10021321 [exp]	17.2	0.8849
AT2G12550		NUB1	homolog of human NUB1, ubiquit...		Lus10008818 [exp]	32.0	0.8535
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10020437 [exp]	33.8	0.8571
AT4G27290			S-locus lectin protein kinase ...		Lus10038552 [exp]	34.5	0.8712
AT5G17000			Zinc-binding dehydrogenase fam...		Lus10004379 [exp]	36.4	0.8679
AT1G47530			MATE efflux family protein (.1...		Lus10042130 [exp]	43.4	0.8569
AT4G06534			unknown protein		Lus10024806 [exp]	44.0	0.8631

Compare expression of checked genes

Lus10040858 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.