Lus10040877 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004924 87 / 1e-22 AT3G18960 81 / 1e-18 AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10040877 pacid=23157889 polypeptide=Lus10040877 locus=Lus10040877.g ID=Lus10040877.BGIv1.0 annot-version=v1.0
ATGGATTTTTTGCCGTTTCCCTGTTCGATGAAATGCGTGAGCAGCTTCCTCGTGACGATATTCAAACCCAATGGATCAGAAACTCGATATCCCCCTCGCA
ACTTGGCCAACGGATCGGACACTGGGTTTGAAGCAGATCCGACTCCCAATGCAGCCAACGGATCGAACGCGGATAGTGCTATAGAAATCGAGGATGGCGA
GGATGAAGAAGATCCTGCTGGCAGTGCTGTCGAAATCGAGGATGACGAGGATGAAGATTGGGTTCCCGACTCGAGGCGAGCGATCCCAGAGGGAATGTCG
GTGCAGGAGAGAGCTTGA
AA sequence
>Lus10040877 pacid=23157889 polypeptide=Lus10040877 locus=Lus10040877.g ID=Lus10040877.BGIv1.0 annot-version=v1.0
MDFLPFPCSMKCVSSFLVTIFKPNGSETRYPPRNLANGSDTGFEADPTPNAANGSNADSAIEIEDGEDEEDPAGSAVEIEDDEDEDWVPDSRRAIPEGMS
VQERA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040877 0 1
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10040043 7.9 0.7122
AT4G10320 tRNA synthetase class I (I, L,... Lus10025306 9.5 0.6480
Lus10023200 16.4 0.6160
AT1G74100 SOT16, ATSOT16,... CORONATINE INDUCED-7, ARABIDOP... Lus10018047 36.2 0.6093
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10013728 37.9 0.6002
AT2G23600 ATMES2, ACL, AT... ARABIDOPSIS THALIANA METHYL ES... Lus10012854 41.0 0.6002
AT1G72520 ATLOX4, LOX4 Arabidopsis thaliana lipoxygen... Lus10027379 41.4 0.5328
Lus10007677 43.5 0.5828
Lus10026928 43.8 0.6002
AT1G65730 YSL7 YELLOW STRIPE like 7 (.1) Lus10010205 45.0 0.5102

Lus10040877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.