Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21550 54 / 6e-11 Calcium-binding EF-hand family protein (.1) AT5G37770 38 / 8e-05 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT4G20780 38 / 0.0001 CML42 calmodulin like 42 (.1) AT4G12860 36 / 0.0004 UNE14 unfertilized embryo sac 14, EF hand calcium-binding protein family (.1) AT2G15680 36 / 0.0008 AtCML30 calmodulin-like 30, Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029730 [exp] 113 / 8e-35 AT1G21550 68 / 8e-16 Calcium-binding EF-hand family protein (.1) Lus10042761 [exp] 105 / 1e-30 AT1G21550 70 / 7e-16 Calcium-binding EF-hand family protein (.1) Lus10000972 [exp] 86 / 5e-23 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10028657 [exp] 79 / 7e-20 AT1G21550 122 / 9e-36 Calcium-binding EF-hand family protein (.1) Lus10042762 [exp] 44 / 2e-06 AT1G77260 741 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10020389 [exp] 37 / 6e-05 AT3G07490 130 / 1e-40 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10009127 [exp] 38 / 0.0002 AT1G66400 147 / 2e-44 calmodulin like 23 (.1) Lus10019055 [exp] 37 / 0.0002 AT1G32250 93 / 9e-25 Calcium-binding EF-hand family protein (.1) Lus10009564 [exp] 37 / 0.0003 AT3G07490 233 / 7e-80 calmodulin-like 3, ARF-GAP domain 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G183300 [exp] 68 / 3e-16 AT1G21550 136 / 1e-41 Calcium-binding EF-hand family protein (.1) Potri.002G077300 [exp] 67 / 1e-15 AT1G21550 123 / 3e-36 Calcium-binding EF-hand family protein (.1) Potri.017G126200 [exp] 40 / 3e-05 AT1G66400 155 / 5e-49 calmodulin like 23 (.1) Potri.004G089400 [exp] 37 / 0.0002 AT1G66400 157 / 7e-50 calmodulin like 23 (.1) Potri.017G029700 [exp] 37 / 0.0003 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.009G102500 [exp] 37 / 0.0003 AT2G15680 246 / 3e-84 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Potri.007G128600 [exp] 37 / 0.0004 AT2G43290 218 / 3e-72 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.005G128100 [exp] 36 / 0.0005 AT3G50770 188 / 7e-61 calmodulin-like 41 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10040888 pacid=23157610 polypeptide=Lus10040888 locus=Lus10040888.g ID=Lus10040888.BGIv1.0 annot-version=v1.0 ATGTCCTCCGGCGATGGTGGAATCCACGCCGGCGACTTGCGGCAGATCTTCCACCAGCTAGACCGGAATGGGGACGGCATTCTCAGCGTTGACGAGCTGA GCAAGCTTCTCGAGCGAATCGGAGCAAGCATCAGCCACTTCACAATCGAGGAGCTGGAGTGTTCTATAGGGAAATCCACCCTCGATTTCGACGAGCTCTT GGAATTCTAA
AA sequence Show only first row Show all	>Lus10040888 pacid=23157610 polypeptide=Lus10040888 locus=Lus10040888.g ID=Lus10040888.BGIv1.0 annot-version=v1.0 MSSGDGGIHAGDLRQIFHQLDRNGDGILSVDELSKLLERIGASISHFTIEELECSIGKSTLDFDELLEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21550			Calcium-binding EF-hand family...		Lus10040888 [exp]	0	1
					Lus10013743 [exp]	2.0	0.7333
AT1G80780			Polynucleotidyl transferase, r...		Lus10032797 [exp]	9.2	0.5979
					Lus10013380 [exp]	16.2	0.6072
AT3G27810	MYB	AtMYB3, ATMYB21	ARABIDOPSIS THALIANA MYB DOMA...		Lus10022259 [exp]	18.5	0.6148
AT3G19340			Protein of unknown function (D...		Lus10041510 [exp]	24.2	0.5590
AT2G32885			Rapid alkalinization factor (R...		Lus10000923 [exp]	30.4	0.5950
AT5G46230			Protein of unknown function, D...		Lus10033612 [exp]	36.4	0.5782
AT3G14880			unknown protein		Lus10039196 [exp]	38.8	0.5886
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10017701 [exp]	45.8	0.5779
AT3G06030		AtANP3, MAPKKK1...	NPK1-related protein kinase 3 ...		Lus10031963 [exp]	63.5	0.5271

Compare expression of checked genes

Lus10040888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.