Lus10040889 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G53000 146 / 2e-43 AtCKS, KDSB CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
AT3G48450 57 / 3e-11 RPM1-interacting protein 4 (RIN4) family protein (.1)
AT5G63270 56 / 7e-11 RPM1-interacting protein 4 (RIN4) family protein (.1)
AT5G55850 56 / 2e-10 NOI RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
AT5G40645 55 / 2e-10 RPM1-interacting protein 4 (RIN4) family protein (.1)
AT2G04410 52 / 2e-09 RPM1-interacting protein 4 (RIN4) family protein (.1)
AT2G17660 51 / 5e-09 RPM1-interacting protein 4 (RIN4) family protein (.1)
AT4G35655 50 / 2e-08 RPM1-interacting protein 4 (RIN4) family protein (.1)
AT3G25070 47 / 2e-06 RIN4 RPM1 interacting protein 4 (.1)
AT5G19473 39 / 0.0002 RPM1-interacting protein 4 (RIN4) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014797 170 / 2e-52 AT1G53000 496 / 3e-179 CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Lus10012316 57 / 4e-11 AT5G55850 87 / 4e-24 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Lus10006361 57 / 4e-11 AT5G55850 73 / 7e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Lus10022524 56 / 2e-10 AT2G04410 104 / 2e-31 RPM1-interacting protein 4 (RIN4) family protein (.1)
Lus10016623 55 / 2e-10 AT2G04410 105 / 1e-31 RPM1-interacting protein 4 (RIN4) family protein (.1)
Lus10025949 54 / 7e-10 AT2G17660 87 / 2e-24 RPM1-interacting protein 4 (RIN4) family protein (.1)
Lus10014574 53 / 1e-09 AT5G55850 76 / 1e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Lus10032112 54 / 2e-09 AT5G55850 80 / 1e-20 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Lus10022776 46 / 4e-06 AT3G25070 155 / 4e-47 RPM1 interacting protein 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G120100 156 / 3e-47 AT1G53000 485 / 3e-175 CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.001G400900 147 / 7e-44 AT1G53000 481 / 1e-173 CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.011G094200 60 / 1e-11 AT5G55850 123 / 8e-38 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Potri.012G092601 59 / 2e-11 AT2G04410 78 / 3e-20 RPM1-interacting protein 4 (RIN4) family protein (.1)
Potri.015G089201 58 / 2e-11 AT2G04410 90 / 1e-25 RPM1-interacting protein 4 (RIN4) family protein (.1)
Potri.001G368900 55 / 2e-10 AT5G55850 124 / 4e-39 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Potri.001G338500 54 / 3e-10 AT5G40645 82 / 1e-22 RPM1-interacting protein 4 (RIN4) family protein (.1)
Potri.014G168900 53 / 1e-09 AT2G04410 102 / 1e-30 RPM1-interacting protein 4 (RIN4) family protein (.1)
Potri.002G245400 51 / 6e-08 AT3G25070 169 / 3e-52 RPM1 interacting protein 4 (.1)
Potri.011G022000 41 / 0.0001 AT3G25070 74 / 6e-16 RPM1 interacting protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05627 AvrRpt-cleavage Cleavage site for pathogenic type III effector avirulence factor Avr
Representative CDS sequence
>Lus10040889 pacid=23157737 polypeptide=Lus10040889 locus=Lus10040889.g ID=Lus10040889.BGIv1.0 annot-version=v1.0
ATGCAGGCGGCGGCGGGGGGAGGAGGGGTAGCGTTGCCGAAATTCGGGGATTGGGATGTGGACAACCCATCCGACTCTGCTCAAGGATATACCGTTATTT
TCAATAAGGCAAGAGACGACAAGAAGACCACCAAAGCAAACCCAGCAGCTGAAGCTGATTCCCAATTACAACCAGCAGCAGCACCTATTGATCATAATAA
TAATAATAACAGTAATGATTACGATTCTCCAACTTTCAACAAAAATGAACCTTACCATCCTCCCCAGTCCTCTCGCAAGGGAGATGAGCCTTCGATTGAA
CCTGAGATTATCGATGGAATTGTGAAAGCACTGCAGGGATCCCCAGATGCAGTGATTAGCACTGCAGTAACAGCCTTGAAACCTGAAGATGCATTTGATC
CTAATCGTCTTCAACCTACTCCTCTACAACTAGAAGAGGATTTGGAACAGCTTAAGGTCCTTGAGAATGGCTATAAAATGAAGGTAATAAAAGTTGACCA
TGAAGCTCACGGTATTGATGCCCCAGAAGATGTTGGCAAGATTGAAGCTCTGATGCGTGAGCAAAACTTACCCTAG
AA sequence
>Lus10040889 pacid=23157737 polypeptide=Lus10040889 locus=Lus10040889.g ID=Lus10040889.BGIv1.0 annot-version=v1.0
MQAAAGGGGVALPKFGDWDVDNPSDSAQGYTVIFNKARDDKKTTKANPAAEADSQLQPAAAPIDHNNNNNSNDYDSPTFNKNEPYHPPQSSRKGDEPSIE
PEIIDGIVKALQGSPDAVISTAVTALKPEDAFDPNRLQPTPLQLEEDLEQLKVLENGYKMKVIKVDHEAHGIDAPEDVGKIEALMREQNLP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53000 AtCKS, KDSB CMP-KDO synthetase, Nucleotide... Lus10040889 0 1
Lus10040407 4.2 0.9803
AT5G45840 Leucine-rich repeat protein ki... Lus10029228 4.7 0.8340
AT2G16910 bHLH AMS, bHLH021 ABORTED MICROSPORES, basic hel... Lus10042395 4.9 0.8218
AT3G51550 FER FERONIA, Malectin/receptor-lik... Lus10022104 5.2 0.7791
Lus10024501 5.3 0.7686
AT2G02450 NAC LOV1, ANAC034, ... LONG VEGETATIVE PHASE 1, Arabi... Lus10003366 5.6 0.7573
AT4G13420 HAK5, ATHAK5 high affinity K+ transporter 5... Lus10005194 6.0 0.9803
Lus10027667 7.3 0.9803
Lus10015682 8.5 0.9803
AT1G05660 Pectin lyase-like superfamily ... Lus10010584 9.5 0.7672

Lus10040889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.