Lus10040897 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62940 339 / 8e-117 Cysteine proteinases superfamily protein (.1.2.3)
AT5G67170 75 / 5e-15 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 65 / 1e-11 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT2G38025 51 / 2e-07 Cysteine proteinases superfamily protein (.1)
AT5G04250 44 / 0.0001 Cysteine proteinases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005939 532 / 0 AT3G62940 363 / 9e-126 Cysteine proteinases superfamily protein (.1.2.3)
Lus10005193 71 / 2e-13 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10006255 62 / 1e-10 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Lus10013303 62 / 2e-10 AT2G27350 468 / 7e-162 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10010459 46 / 1e-05 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G134100 400 / 4e-141 AT3G62940 338 / 9e-116 Cysteine proteinases superfamily protein (.1.2.3)
Potri.004G196800 73 / 3e-14 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.009G160100 71 / 1e-13 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 62 / 1e-10 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.016G110400 50 / 6e-07 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.006G057400 48 / 5e-06 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 46 / 1e-05 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 45 / 2e-05 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.016G019700 40 / 0.0009 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10040897 pacid=23179643 polypeptide=Lus10040897 locus=Lus10040897.g ID=Lus10040897.BGIv1.0 annot-version=v1.0
ATGCTCGCCAGGCATAGGAAGGAGACAACAGCGCTGCAGAACAAAGAAATTGAACTGAAGAAGGGGGCTGCGAAAGGGAGCAAAACAGAACAGAAAGCCA
AGAAGAAGCAAGTTGAAGAACAAATAACACGGCTTTCTACTGAGCTCAAAGAGAAGCAAGCACAAGAGCTTGCTTCATTAGGCTATGTCAATAACAATGA
CAGCGAGAAAGGCAACCTAGACACGCTAGTGAAGGCCATAGCTGGGGTTTCTGTCAGCAGTCCCATTGCTGATAACAACACCAGGAGGAGCAAAGGTGGG
AAAAGGAAAGATAAGAGAGCTCAGCAAGAAGCTGAGAGAGAGAAGAGGATCCAGGAAGAACAGAGCAACCTTGTGAGTGACAGAATGATTGAAGACGAGA
AATTGGGGAGAAAGCTCGAGCCCCTTGGGTTGACTGTTAATGAGATCAAACCGGATGGTAATTGCCTCTACCGAGCTGTGGAAGACCAGTTAGCTCTCCT
ATCTGGCGGTTCTTCTCCATATAGCTATCAAGATCTCCGGGAAATGGTGGCAGCGTATATGAGAAAGAACTCGTCGGAGTTCCTGCCGTTTTTCCTTTCC
GAGACAGAAACTGCAGAAGAAGCAGACTCTGACAGTACTCTGGCGGAAAGATTCGAGAGTTACTGTAAGGAAATCGAATCGACAGCTGCGTGGGGTGGAC
AGCTGGAGCTGGGTGCTTTGACTCACTGCTTGAGGAGGCCTATAATGATATATTCAGGATCGTTCCCTGATGTTGAGATGGGGAAGGAATACAAACCAGG
TGGTGCTTCGTCGTCTACAGCAGCAAATATTATGCTGTCATATCATAAGCATGCCTTTGGGCTTGGGGAACATTACAACTCTGTAGTTCCCAGTTTGATT
AGGTAG
AA sequence
>Lus10040897 pacid=23179643 polypeptide=Lus10040897 locus=Lus10040897.g ID=Lus10040897.BGIv1.0 annot-version=v1.0
MLARHRKETTALQNKEIELKKGAAKGSKTEQKAKKKQVEEQITRLSTELKEKQAQELASLGYVNNNDSEKGNLDTLVKAIAGVSVSSPIADNNTRRSKGG
KRKDKRAQQEAEREKRIQEEQSNLVSDRMIEDEKLGRKLEPLGLTVNEIKPDGNCLYRAVEDQLALLSGGSSPYSYQDLREMVAAYMRKNSSEFLPFFLS
ETETAEEADSDSTLAERFESYCKEIESTAAWGGQLELGALTHCLRRPIMIYSGSFPDVEMGKEYKPGGASSSTAANIMLSYHKHAFGLGEHYNSVVPSLI
R

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G62940 Cysteine proteinases superfami... Lus10040897 0 1
AT5G53070 Ribosomal protein L9/RNase H1 ... Lus10005909 6.0 0.8701
AT4G27130 Translation initiation factor ... Lus10027181 12.5 0.8999
AT3G14460 LRR and NB-ARC domains-contain... Lus10039548 14.7 0.8610
AT4G16720 Ribosomal protein L23/L15e fam... Lus10009017 15.4 0.8336
AT4G02080 ASAR1, ATSARA1C... secretion-associated RAS super... Lus10031408 19.9 0.8630
AT2G34750 RNA polymerase I specific tran... Lus10026162 23.2 0.8191
AT1G11040 HSP40/DnaJ peptide-binding pro... Lus10042725 36.2 0.8596
AT1G72680 ATCAD1 CINNAMYL ALCOHOL DEHYDROGENASE... Lus10017354 37.1 0.8631
AT1G64385 unknown protein Lus10033958 37.4 0.8527
AT5G60340 P-loop containing nucleoside t... Lus10040792 43.8 0.7983

Lus10040897 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.