Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) AT2G47870 158 / 7e-52 Thioredoxin superfamily protein (.1) AT3G21460 134 / 3e-42 Glutaredoxin family protein (.1) AT4G15700 114 / 3e-34 Thioredoxin superfamily protein (.1) AT2G47880 113 / 5e-34 Glutaredoxin family protein (.1) AT4G15680 112 / 7e-34 Thioredoxin superfamily protein (.1) AT4G15670 112 / 8e-34 Thioredoxin superfamily protein (.1) AT4G15660 112 / 1e-33 Thioredoxin superfamily protein (.1) AT4G15690 112 / 1e-33 Thioredoxin superfamily protein (.1) AT5G18600 111 / 2e-33 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005938 [exp] 214 / 5e-74 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 136 / 4e-43 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10033965 [exp] 119 / 2e-36 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 117 / 2e-35 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10029441 [exp] 103 / 4e-30 AT3G62930 145 / 1e-46 Thioredoxin superfamily protein (.1) Lus10005941 [exp] 103 / 4e-30 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1) Lus10040899 [exp] 102 / 1e-29 AT2G30540 140 / 5e-45 Thioredoxin superfamily protein (.1) Lus10005937 [exp] 100 / 4e-29 AT2G47880 138 / 7e-44 Glutaredoxin family protein (.1) Lus10035183 [exp] 97 / 3e-27 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G208500 [exp] 185 / 1e-62 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1) Potri.014G134200 [exp] 183 / 7e-62 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 142 / 1e-45 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.014G134300 [exp] 122 / 1e-37 AT2G30540 157 / 1e-51 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 118 / 5e-36 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.002G208400 [exp] 118 / 6e-36 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 117 / 2e-35 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 116 / 2e-35 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.002G209300 [exp] 112 / 1e-33 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 110 / 1e-32 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10040898 pacid=23179722 polypeptide=Lus10040898 locus=Lus10040898.g ID=Lus10040898.BGIv1.0 annot-version=v1.0 ATGGACAGAGTCAGAGACTTGGCATCGAAGAAGGCGGCGGTGATCTTCACCAAGAGCACGTGCTGCATGTGCCACAGCATCAAACAGCTCTTCTACGAGC TGGGGGCCAGCCCAGCGATTCACGAGGTGGATCGGGAGGCTAACGGCAGGGAAATGGAGTGGGCTCTCCGGTCGCTGGGGTACTCCACCACCGTCCCTGC CGTGTTCATAGGAGGGAGATACGTCGGGTCCGCTAAGGAAGTCTTGTCGCTTCACCTCGACGGAACTCTCAAGCAAATGCTTATAGATGCAAATGCCATC TGGTTCTAG
AA sequence Show only first row Show all	>Lus10040898 pacid=23179722 polypeptide=Lus10040898 locus=Lus10040898.g ID=Lus10040898.BGIv1.0 annot-version=v1.0 MDRVRDLASKKAAVIFTKSTCCMCHSIKQLFYELGASPAIHEVDREANGREMEWALRSLGYSTTVPAVFIGGRYVGSAKEVLSLHLDGTLKQMLIDANAI WF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62950			Thioredoxin superfamily protei...		Lus10040898 [exp]	0	1
					Lus10007992 [exp]	2.8	0.8553
AT1G32400		TOM2A	tobamovirus multiplication 2A ...		Lus10040108 [exp]	6.6	0.8177
AT5G65660			hydroxyproline-rich glycoprote...		Lus10032818 [exp]	9.5	0.8117
AT4G08570			Heavy metal transport/detoxifi...		Lus10039419 [exp]	10.8	0.8200
					Lus10005609 [exp]	11.1	0.8177
AT3G57170			N-acetylglucosaminyl transfera...		Lus10003248 [exp]	13.0	0.7898
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10022663 [exp]	17.9	0.7587
AT5G49650		XK2, XK-2	XYLULOSE KINASE 2, xylulose ki...		Lus10007234 [exp]	17.9	0.8136
AT3G07310			Protein of unknown function (D...		Lus10038208 [exp]	19.7	0.7920
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Lus10021707 [exp]	19.8	0.8117

Compare expression of checked genes

Lus10040898 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.