Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30540 141 / 4e-45 Thioredoxin superfamily protein (.1) AT2G47880 139 / 2e-44 Glutaredoxin family protein (.1) AT1G06830 135 / 9e-43 Glutaredoxin family protein (.1) AT3G62960 133 / 6e-42 Thioredoxin superfamily protein (.1) AT3G62950 113 / 6e-34 Thioredoxin superfamily protein (.1) AT2G47870 107 / 2e-31 Thioredoxin superfamily protein (.1) AT3G21460 98 / 5e-28 Glutaredoxin family protein (.1) AT5G14070 98 / 1e-27 ROXY2 Thioredoxin superfamily protein (.1) AT4G15670 92 / 1e-25 Thioredoxin superfamily protein (.1) AT4G15660 92 / 1e-25 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005937 [exp] 210 / 2e-72 AT2G47880 138 / 7e-44 Glutaredoxin family protein (.1) Lus10035183 [exp] 106 / 1e-30 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 103 / 3e-30 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 103 / 5e-30 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10040898 [exp] 102 / 2e-29 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 102 / 2e-29 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10005938 [exp] 101 / 3e-29 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 100 / 2e-28 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 89 / 8e-24 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G208400 [exp] 153 / 5e-50 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1) Potri.014G134300 [exp] 146 / 5e-47 AT2G30540 157 / 1e-51 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 117 / 3e-35 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 114 / 5e-34 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 112 / 2e-33 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 109 / 2e-32 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.010G021800 [exp] 104 / 2e-30 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 102 / 8e-30 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 100 / 6e-29 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.002G208500 [exp] 99 / 2e-28 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10040899 pacid=23179772 polypeptide=Lus10040899 locus=Lus10040899.g ID=Lus10040899.BGIv1.0 annot-version=v1.0 ATGGAGAAGGTGATGAGTTTGGCATCGGAAAACGGGGTGGTGATCTTCAGCAAGAGCTCATGTTGCATGTGTTATGCGGTGAACATGTTGTTCCAAGGGA TAGGAGTCAAGCCGGTGGTCTACGACATCGACCAGGACCCTGAAGGCTGCAGGGACATGGAGAAGGCACTCATGAAGCTTGGAACCACCACCGGACCGGT CCCTGCTGTGTTCATCGGGGGCAAGTTCATGGGTTCCACTAATGAGATCATGTCCGCTCATCTTAGTGGCCAGCTCGTTCACATGCTCAAGCCTTACCAG TCATTGTCTTGA
AA sequence Show only first row Show all	>Lus10040899 pacid=23179772 polypeptide=Lus10040899 locus=Lus10040899.g ID=Lus10040899.BGIv1.0 annot-version=v1.0 MEKVMSLASENGVVIFSKSSCCMCYAVNMLFQGIGVKPVVYDIDQDPEGCRDMEKALMKLGTTTGPVPAVFIGGKFMGSTNEIMSAHLSGQLVHMLKPYQ SLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30540			Thioredoxin superfamily protei...		Lus10040899 [exp]	0	1
AT3G60720		PDLP8	plasmodesmata-located protein ...		Lus10036497 [exp]	1.0	0.9521
AT5G24620			Pathogenesis-related thaumatin...		Lus10015591 [exp]	4.2	0.9486
AT5G64240		AtMCP1a, ATMC3	metacaspase 1a, metacaspase 3 ...		Lus10035630 [exp]	4.9	0.9442
AT5G24620			Pathogenesis-related thaumatin...		Lus10032914 [exp]	5.7	0.9482
					Lus10041944 [exp]	5.8	0.9243
AT2G18196			Heavy metal transport/detoxifi...		Lus10008284 [exp]	6.3	0.9434
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Lus10033405 [exp]	10.9	0.9409
AT5G01750			Protein of unknown function (D...		Lus10025254 [exp]	11.5	0.8997
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Lus10039864 [exp]	11.5	0.9307
AT4G27290			S-locus lectin protein kinase ...		Lus10016862 [exp]	11.6	0.9310

Compare expression of checked genes

Lus10040899 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.