Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01360 265 / 2e-91 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT5G53160 259 / 2e-89 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT4G01026 256 / 1e-87 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT4G27920 251 / 6e-86 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT5G05440 162 / 5e-51 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G38310 161 / 2e-50 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 159 / 3e-49 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT4G17870 152 / 6e-47 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G26040 147 / 3e-45 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT5G46790 135 / 3e-40 RCAR12, PYL1 regulatory components of ABA receptor 12, PYR1-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001059 [exp] 266 / 1e-91 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10039335 [exp] 256 / 1e-87 AT5G53160 295 / 4e-103 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10038818 [exp] 246 / 2e-83 AT5G53160 287 / 1e-99 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10014929 [exp] 244 / 7e-83 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10009812 [exp] 241 / 8e-83 AT1G01360 157 / 5e-50 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Lus10014239 [exp] 176 / 8e-56 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 174 / 3e-54 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 168 / 9e-53 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 157 / 9e-50 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G169400 [exp] 293 / 2e-102 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.014G097100 [exp] 288 / 1e-100 AT1G01360 301 / 6e-106 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.001G092500 [exp] 271 / 5e-94 AT5G53160 296 / 7e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G139200 [exp] 267 / 2e-92 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.015G020500 [exp] 265 / 2e-91 AT5G53160 304 / 7e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.012G000800 [exp] 263 / 9e-91 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.016G125400 [exp] 173 / 9e-55 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 172 / 2e-54 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.001G142500 [exp] 164 / 9e-52 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G183900 [exp] 163 / 5e-51 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10040916 pacid=23179551 polypeptide=Lus10040916 locus=Lus10040916.g ID=Lus10040916.BGIv1.0 annot-version=v1.0 ATGACCATCATCAATGGCGATTGCGGCAGCGCATTGGAGGCGCAGTACATCTGGATGCACCATCGCCACCAGACGGCCGATAATCAGTGTTCTTCTAACC TCGTCACGCACATCAAAGCCCCCGTCGACATCGTATGGTCTCTGGTGAGGCGATTTGACGAGCCACAGACTTACAAGCCATTCATAAGTAGGTGTGTCAT GAATGGTGAAGTTGGGATTGGAAGTCTCAGACATGTGAATGTCAGGTCTGGACTCCCTGCAACCACCAGCACTGAAAGATTGGAGCTCTTCGATGATGAA GAACACATCCTCGGTATCAAGATCGTCGATGGTGATCACCGGCTAAAGAACTACTCTTCTGTTATAACGGTCCATCCCGAGGTTATCGATGGAAGGCCCG GGACATTGGTCATCGAGTCTTTCGTGGTGGATGTGCCTCAGGGGAACACCAAGGAGGATACTTGCTATTTTGTAAGTGCCCTTATCAATTGCAATTTGAG ATCTTTGACAGAGATCTCGGAGAGGATGGCTGTGCCTCCGCCTGGAATGAACTGA
AA sequence Show only first row Show all	>Lus10040916 pacid=23179551 polypeptide=Lus10040916 locus=Lus10040916.g ID=Lus10040916.BGIv1.0 annot-version=v1.0 MTIINGDCGSALEAQYIWMHHRHQTADNQCSSNLVTHIKAPVDIVWSLVRRFDEPQTYKPFISRCVMNGEVGIGSLRHVNVRSGLPATTSTERLELFDDE EHILGIKIVDGDHRLKNYSSVITVHPEVIDGRPGTLVIESFVVDVPQGNTKEDTCYFVSALINCNLRSLTEISERMAVPPPGMN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01360		PYL9, RCAR1	PYRABACTIN RESISTANCE 1-LIKE 9...		Lus10040916 [exp]	0	1
AT1G01360		PYL9, RCAR1	PYRABACTIN RESISTANCE 1-LIKE 9...		Lus10009812 [exp]	1.0	0.9329
AT4G14540	CCAAT	NF-YB3	"nuclear factor Y, subunit B3"...		Lus10016616 [exp]	3.5	0.9014
AT2G01680			Ankyrin repeat family protein ...		Lus10021814 [exp]	6.5	0.8671
AT5G60850	DOF	OBP4, AtDof5. 4	OBF binding protein 4 (.1)		Lus10034652 [exp]	10.5	0.9000
AT1G54115		ATCCX4	cation calcium exchanger 4 (.1...		Lus10037681 [exp]	11.0	0.8683
AT1G01470		LSR3, LEA14	LIGHT STRESS-REGULATED 3, LATE...		Lus10007905 [exp]	11.8	0.8928
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10029131 [exp]	13.0	0.8863
AT3G52060			Core-2/I-branching beta-1,6-N-...		Lus10028866 [exp]	18.5	0.8696
AT1G65720			unknown protein		Lus10031363 [exp]	20.4	0.8752
AT3G53030		SRPK4	ser/arg-rich protein kinase 4 ...		Lus10020516 [exp]	21.9	0.8540

Compare expression of checked genes

Lus10040916 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.