Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040920 pacid=23179538 polypeptide=Lus10040920 locus=Lus10040920.g ID=Lus10040920.BGIv1.0 annot-version=v1.0 ATGGCATTCCCAGGCTGGAGGATTTGTGATGGTGGCGACAGTAAAGGACGGTCCTCCGGCTATATCAGGAAGACTTGTTTGGTGGCGACGGTAAAGGACG GTCCATGGGCTATATCAGGAAGACTTGTTTGTCTGGTGTCTCTCTTGCTGTCCCCTATATTAAGGGATTATGTGTAG
AA sequence Show only first row Show all	>Lus10040920 pacid=23179538 polypeptide=Lus10040920 locus=Lus10040920.g ID=Lus10040920.BGIv1.0 annot-version=v1.0 MAFPGWRICDGGDSKGRSSGYIRKTCLVATVKDGPWAISGRLVCLVSLLLSPILRDYV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040920 [exp]	0	1
AT3G09870			SAUR-like auxin-responsive pro...		Lus10023011 [exp]	1.4	0.9123
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Lus10000225 [exp]	1.7	0.9067
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10042328 [exp]	2.2	0.9138
AT5G04260		WCRKC2	WCRKC thioredoxin 2 (.1)		Lus10038703 [exp]	4.2	0.8887
AT3G13970		APG12B, APG12	AUTOPHAGY 12 B, AUTOPHAGY 12, ...		Lus10000432 [exp]	4.5	0.8971
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Lus10037992 [exp]	5.3	0.8990
					Lus10031246 [exp]	5.5	0.8763
AT3G17700		ATCNGC20, CNBT1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10031891 [exp]	6.5	0.8964
AT3G61800			unknown protein		Lus10004000 [exp]	12.4	0.8902
AT4G20410		GAMMA-SNAP, GSN...	gamma-soluble NSF attachment p...		Lus10013109 [exp]	13.3	0.8066

Compare expression of checked genes

Lus10040920 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.