Lus10040926 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47710 104 / 4e-26 Serine protease inhibitor (SERPIN) family protein (.1)
AT2G25240 103 / 7e-26 Serine protease inhibitor (SERPIN) family protein (.1)
AT3G45220 102 / 3e-25 Serine protease inhibitor (SERPIN) family protein (.1)
AT1G64030 94 / 4e-22 ATSRP3 serpin 3 (.1)
AT2G26390 90 / 7e-21 Serine protease inhibitor (SERPIN) family protein (.1)
AT2G35580 89 / 2e-20 Serine protease inhibitor (SERPIN) family protein (.1)
AT1G62170 88 / 4e-20 Serine protease inhibitor (SERPIN) family protein (.1), Serine protease inhibitor (SERPIN) family protein (.2)
AT2G14540 77 / 2e-16 ATSRP2 serpin 2 (.1)
AT1G63280 62 / 2e-12 Serine protease inhibitor (SERPIN) family protein (.1)
AT1G51330 56 / 1e-09 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019009 280 / 1e-93 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10032600 179 / 8e-56 AT1G47710 99 / 6e-24 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10009905 153 / 2e-47 AT2G14540 72 / 1e-15 serpin 2 (.1)
Lus10032754 120 / 5e-32 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10002792 118 / 4e-31 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10039336 109 / 3e-28 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10034364 109 / 1e-27 AT1G47710 296 / 4e-97 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10034362 102 / 1e-25 AT1G47710 274 / 1e-89 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10005089 96 / 1e-22 AT1G47710 306 / 2e-101 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G100900 110 / 5e-28 AT1G47710 337 / 2e-113 Serine protease inhibitor (SERPIN) family protein (.1)
Potri.014G036000 104 / 6e-26 AT1G47710 476 / 1e-168 Serine protease inhibitor (SERPIN) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00079 Serpin Serpin (serine protease inhibitor)
Representative CDS sequence
>Lus10040926 pacid=23179874 polypeptide=Lus10040926 locus=Lus10040926.g ID=Lus10040926.BGIv1.0 annot-version=v1.0
ATGGCAGCCTTGCGCCTAGCCGCTCCGTCGAAAAGCGAGCAGGCGGCAACCGTGTCTCACGCCAACGCGGTTTGGGTGGATCGGAAATTCTCGTTGAGCA
AATCATTCAAGAAGGTGGTTACTGAAGTATACCATGCCGATACCGACGACACTGCCGATTTTGCATCCCAGCCTGAAAAAGCAGTCAAGGAAATTAACGC
ATGGGTGGAGAAATCAACCAAAGGATGCATCGGTAACCTCGTCAGCTCTCAAGACATAAACTCTACAACAGTGTTAATCCTGGCCAACGCACTCTACTTC
AAAGGTTGCTTCCCAGACTACCTCTTCTCTTCCTCTAACACATCAGATGATACATTCCGCTGCCTCAACAAAACTGATAAAGTCACCGTCCCCTTCATGA
ACAACTCCAGAGTCGACCTACATTTCGCCAGCTTTGATGATTTTAAGGTCCTCGAGCTTCCCTATGAATCGTCAAATTTCCGAGCCGATAAAAAGTGCCC
CCGATTCTCCATGTACATCCTTCCCCGGAACCGAAACGGGCTTCCTCAAATGCTACGCAAGTATTTTGGCAGCTCGAATCCTGGTCAGGAAATTTTACAA
ACACTTGGCAAACACAAGAAGCAGTTGCTCGGAAAAGTGCGTATTCCCAAGTGGAAATTCTCCCTCAGGTGCCATCTTAAGAAGACAAGGGCTCATGTTG
CTGTTTGA
AA sequence
>Lus10040926 pacid=23179874 polypeptide=Lus10040926 locus=Lus10040926.g ID=Lus10040926.BGIv1.0 annot-version=v1.0
MAALRLAAPSKSEQAATVSHANAVWVDRKFSLSKSFKKVVTEVYHADTDDTADFASQPEKAVKEINAWVEKSTKGCIGNLVSSQDINSTTVLILANALYF
KGCFPDYLFSSSNTSDDTFRCLNKTDKVTVPFMNNSRVDLHFASFDDFKVLELPYESSNFRADKKCPRFSMYILPRNRNGLPQMLRKYFGSSNPGQEILQ
TLGKHKKQLLGKVRIPKWKFSLRCHLKKTRAHVAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47710 Serine protease inhibitor (SER... Lus10040926 0 1
Lus10032002 1.4 0.9301
AT1G52540 Protein kinase superfamily pro... Lus10001323 2.0 0.9221
AT1G24190 SNL3, AtSin3 ARABIDOPSIS THALIANA SIN3 HOMO... Lus10042336 6.9 0.9219
Lus10001186 8.0 0.9166
Lus10000984 8.9 0.9135
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10004158 9.8 0.9135
AT5G20260 Exostosin family protein (.1) Lus10027707 9.8 0.7011
AT3G05550 Hypoxia-responsive family prot... Lus10031490 10.6 0.9135
Lus10017835 11.3 0.9135
AT3G20190 Leucine-rich repeat protein ki... Lus10034795 11.6 0.6625

Lus10040926 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.