Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00560 81 / 4e-20 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009821 [exp] 107 / 7e-30 AT4G00560 417 / 3e-147 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G079700 [exp] 79 / 3e-19 AT4G00560 436 / 1e-154 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040929 pacid=23179831 polypeptide=Lus10040929 locus=Lus10040929.g ID=Lus10040929.BGIv1.0 annot-version=v1.0 ATGGCTAAGGTGGTGGCACTCGTAAGAGAACACGATGCACGCTTGATCAAGAGAGTCTCGGCATCATCGGTTGATAGGGGTGTTCGTTCCCCTTCTGATA TCTCAATGGACGTTTCCAAACTGGTTAACAAACTTGGTATTCGACCTACTCCATTCAAAGATGGCGTCAAATTCACTCTTGACAGTGCTTGA
AA sequence Show only first row Show all	>Lus10040929 pacid=23179831 polypeptide=Lus10040929 locus=Lus10040929.g ID=Lus10040929.BGIv1.0 annot-version=v1.0 MAKVVALVREHDARLIKRVSASSVDRGVRSPSDISMDVSKLVNKLGIRPTPFKDGVKFTLDSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00560			NAD(P)-binding Rossmann-fold s...		Lus10040929 [exp]	0	1
AT5G51460		ATTPPA	Haloacid dehalogenase-like hyd...		Lus10027208 [exp]	2.4	0.7447
AT4G36640			Sec14p-like phosphatidylinosit...		Lus10023956 [exp]	6.2	0.7281
AT3G52740			unknown protein		Lus10022717 [exp]	22.9	0.6888
AT3G49250		IDN1, DMS3	INVOLVED IN DE NOVO 1, defecti...		Lus10023253 [exp]	31.3	0.6869
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10025110 [exp]	33.0	0.6596
AT2G23945			Eukaryotic aspartyl protease f...		Lus10002275 [exp]	39.2	0.6467
AT3G59310			Eukaryotic protein of unknown ...		Lus10004060 [exp]	45.8	0.6606
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10003854 [exp]	46.3	0.6736
AT1G12390			Cornichon family protein (.1)		Lus10030270 [exp]	56.9	0.6565
AT1G60190		AtPUB19	plant U-box 19, ARM repeat sup...		Lus10030628 [exp]	87.2	0.6303

Compare expression of checked genes

Lus10040929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.