Lus10040943 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009833 224 / 2e-76 AT4G23180 39 / 7e-04 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10007504 134 / 2e-40 AT3G22040 42 / 3e-05 Domain of unknown function (DUF26) (.1)
Lus10028980 131 / 3e-39 AT3G21945 39 / 9e-04 Receptor-like protein kinase-related family protein (.1)
Lus10026810 44 / 7e-06 AT1G63600 41 / 1e-04 Receptor-like protein kinase-related family protein (.1)
Lus10022828 42 / 3e-05 AT2G01660 43 / 2e-05 plasmodesmata-located protein 6 (.1.2)
Lus10028026 41 / 6e-05 AT4G23290 44 / 1e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2)
Lus10028018 41 / 8e-05 ND 39 / 5e-04
Lus10011894 40 / 0.0001 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1)
Lus10020814 41 / 0.0002 AT5G37660 311 / 2e-106 plasmodesmata-located protein 7 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 41 / 6e-05 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.004G026350 40 / 0.0003 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10040943 pacid=23179857 polypeptide=Lus10040943 locus=Lus10040943.g ID=Lus10040943.BGIv1.0 annot-version=v1.0
ATGGCTCGCCTAGTGATCGTGTTCACAGTCTTCGCCCTCACATTCGGGTCATTCTGCGGACCAGTCAACACCTCCGACGAGGACGATAACTCTTCGGCCG
CATCACCATCACCTCAGGCGACGACTAAGCCGACGACTTCGGGAGTGGTCTGCGACAAGACGAATTACACGAACGTGTACCCGACCAACAGTTACGTGAA
GCATGTCCTTGAGGAGCTGAGCGAAGAAGTGAGCAACAGCAAGGGTTACGCCAAGCTCATCAAGTTCCCCGAAATCGACCGGCCGATTATGTCCGGTCAG
GGGACATGCAAGAAGAACATGACCCAGACGGAATGCGCCAAGTGTATTAAGGACGGCGTGAAGATTGTGCTTGATAGATGCCCGCAGCGGGTTGGAGCTC
AGTTCACTGCCGCCAAGTGCAAACTGAGGTACGACGTTTTCCATGCCTAG
AA sequence
>Lus10040943 pacid=23179857 polypeptide=Lus10040943 locus=Lus10040943.g ID=Lus10040943.BGIv1.0 annot-version=v1.0
MARLVIVFTVFALTFGSFCGPVNTSDEDDNSSAASPSPQATTKPTTSGVVCDKTNYTNVYPTNSYVKHVLEELSEEVSNSKGYAKLIKFPEIDRPIMSGQ
GTCKKNMTQTECAKCIKDGVKIVLDRCPQRVGAQFTAAKCKLRYDVFHA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10040943 0 1
AT3G54030 Protein kinase protein with te... Lus10035550 8.4 0.6994
AT2G28100 ATFUC1 alpha-L-fucosidase 1 (.1) Lus10031681 23.2 0.6758
AT1G72880 Survival protein SurE-like pho... Lus10008390 26.2 0.6737
AT5G48460 Actin binding Calponin homolog... Lus10038235 26.8 0.6760
AT2G17550 unknown protein Lus10016693 29.7 0.6631
AT4G23820 Pectin lyase-like superfamily ... Lus10001899 39.1 0.6602
AT5G50020 DHHC-type zinc finger family p... Lus10020844 42.2 0.6304
AT2G01420 PIN4, ATPIN4 ARABIDOPSIS PIN-FORMED 4, Auxi... Lus10020829 47.0 0.6525
AT2G42380 bZIP ATBZIP34 Basic-leucine zipper (bZIP) tr... Lus10033630 47.8 0.6440
AT5G57480 P-loop containing nucleoside t... Lus10006968 54.0 0.6111

Lus10040943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.