Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05500 177 / 7e-57 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 81 / 2e-19 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G34700 76 / 1e-17 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G33790 73 / 8e-16 ATAGP30 arabinogalactan protein 30 (.1) AT1G28290 57 / 5e-10 AGP31 arabinogalactan protein 31 (.1.2) AT2G47530 52 / 1e-08 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G02270 47 / 1e-06 RHS13 root hair specific 13 (.1) AT5G15780 45 / 1e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G62680 44 / 2e-05 ATPRP3, PRP3 ARABIDOPSIS THALIANA PROLINE-RICH PROTEIN 3, proline-rich protein 3 (.1) AT1G54970 40 / 0.0003 RHS7, ATPRP1 ROOT HAIR SPECIFIC 7, proline-rich protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009837 [exp] 347 / 4e-124 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017440 [exp] 194 / 8e-64 AT5G05500 128 / 7e-38 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10007515 [exp] 172 / 4e-55 AT5G05500 127 / 3e-37 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10015434 [exp] 77 / 4e-17 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2) Lus10014013 [exp] 74 / 5e-16 AT2G34700 137 / 2e-40 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10023887 [exp] 57 / 3e-10 AT3G09925 167 / 4e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10034365 [exp] 49 / 4e-07 AT5G15780 129 / 7e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 47 / 1e-06 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10005086 [exp] 47 / 2e-06 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G185400 [exp] 213 / 4e-71 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.008G072000 [exp] 192 / 8e-63 AT5G05500 152 / 5e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G044700 [exp] 79 / 5e-18 AT2G34700 142 / 8e-43 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G053600 [exp] 75 / 1e-16 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.006G119100 [exp] 61 / 1e-11 AT3G09925 180 / 7e-58 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G201800 [exp] 56 / 1e-09 AT4G02270 118 / 1e-33 root hair specific 13 (.1) Potri.014G126300 [exp] 56 / 2e-09 AT2G47540 114 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126200 [exp] 56 / 3e-09 AT2G47540 114 / 3e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126500 [exp] 55 / 5e-09 AT2G47540 113 / 6e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126250 [exp] 54 / 1e-08 AT2G47540 112 / 2e-29 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10040948 pacid=23179595 polypeptide=Lus10040948 locus=Lus10040948.g ID=Lus10040948.BGIv1.0 annot-version=v1.0 ATGGAACCAAGCAACCACCTGACATCAGTTGCCATCTGCTCTCTCCTTCTCCTCCTCCCATTCATCGAAGCATCCCCAGCAGCATCAGCTGATCAGAAGA AGATATCTAATGTGGTTGTCGAAGGAGTTGTCTACTGCCAGAGCTGCAAAAACTCTGGCTCCTGGTCTCTCTCAGGGGCTAATCCCCTCCACTCTGCTAC AGTCAGTGTCATTTGTAAAAACTCCCACCACCAAGTGAGCTTCTACAAGACGTATCAGACCAACGAATATGGCTACTTCTATGCTCAGCTCGACGGCTTC AAGTTAGGCCATGGCATTTTGGACCATCCTCTTCAAGCCTGCACTGTCAAGCTAGTTTCCTCTCCTCTTCAGACCTGCAATATCCCTACCAACCTCAACT ATGGCATCAAAGGAGCTAAGCTTCGTTTCGAGAACAAGGTCCTCAGGTTCCCTCACTATGAGGCCGTCATCTATGCAGCTGGTCCGTTAGCCTTCCGCCC CAGTGAATGCCCTTCGGCAGCTGAAGAAGATGTGCATGCTTGA
AA sequence Show only first row Show all	>Lus10040948 pacid=23179595 polypeptide=Lus10040948 locus=Lus10040948.g ID=Lus10040948.BGIv1.0 annot-version=v1.0 MEPSNHLTSVAICSLLLLLPFIEASPAASADQKKISNVVVEGVVYCQSCKNSGSWSLSGANPLHSATVSVICKNSHHQVSFYKTYQTNEYGYFYAQLDGF KLGHGILDHPLQACTVKLVSSPLQTCNIPTNLNYGIKGAKLRFENKVLRFPHYEAVIYAAGPLAFRPSECPSAAEEDVHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10040948 [exp]	0	1
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10009837 [exp]	1.0	0.9754
AT4G02270		RHS13	root hair specific 13 (.1)		Lus10041926 [exp]	1.4	0.9607
AT3G10710		RHS12	root hair specific 12 (.1)		Lus10033399 [exp]	3.0	0.9571
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10011112 [exp]	3.2	0.9082
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10039171 [exp]	4.2	0.8445
AT1G63450		RHS8	root hair specific 8 (.1)		Lus10000604 [exp]	4.5	0.9453
AT5G46230			Protein of unknown function, D...		Lus10013912 [exp]	4.7	0.7634
AT1G12560		ATHEXPALPHA1.26...	expansin A7 (.1)		Lus10006711 [exp]	5.0	0.9450
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10043232 [exp]	5.1	0.8931
AT1G48930		ATGH9C1	glycosyl hydrolase 9C1 (.1)		Lus10017402 [exp]	5.5	0.9447

Compare expression of checked genes

Lus10040948 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.