Plant FIBer expression Database

Lus10040955 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38310 40 / 0.0002 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012231
[exp]
42 / 3e-05 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Lus10022675
[exp]
40 / 0.0002 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G104100
[exp]
39 / 0.0003 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Potri.008G073400
[exp]
0 / 1 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
Potri.016G125400
[exp]
0 / 1 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1)
PFAM info
Representative CDS sequence
>Lus10040955 pacid=23179837 polypeptide=Lus10040955 locus=Lus10040955.g ID=Lus10040955.BGIv1.0 annot-version=v1.0
ATGAGGCGGCAGCTCTTGAGGAAGTGCTTGTACGCTTGTGGGTTGTCGAAGCGGCGGATCACCGACCACACTTTATGCACCGGACCACCGCGGAGCAGCA
CTGGTTCGGACGGAGGGTGCGCGTGTGGTGGCGTGCCACGTGGTCCGGCACCACCTCATCATCACCACGTGACTGGTGCAGCAGCTGCACGTGACGGCAC
TCCTCCTCCTCGTGCTTATTGTATTGGGTGTGTGTGGGTTGGGAGAAGGCGGTTCTTTGGAGGTGGAGGAGAGATGGCATGGCTTGAGATTGTCCTTACA
AGGAAGGAAGAGGAAGATGGGAAAGAGCTTTTCGGTGGAGTCGCAGGCGCTAAGCCAATGCATTACGACAGACAGCTGCTAGAGAGGAGGAGCTAG
AA sequence
>Lus10040955 pacid=23179837 polypeptide=Lus10040955 locus=Lus10040955.g ID=Lus10040955.BGIv1.0 annot-version=v1.0
MRRQLLRKCLYACGLSKRRITDHTLCTGPPRSSTGSDGGCACGGVPRGPAPPHHHHVTGAAAARDGTPPPRAYCIGCVWVGRRRFFGGGGEMAWLEIVLT
RKEEEDGKELFGGVAGAKPMHYDRQLLERRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040955
[exp]
0 1
AT1G60400 F-box/RNI-like superfamily pro... Lus10023039
[exp]
5.5 0.7706
AT1G51120 AP2_ERF AP2/B3 transcription factor fa... Lus10026212
[exp]
6.5 0.7528
AT3G53220 Thioredoxin superfamily protei... Lus10026540
[exp]
7.4 0.7548
AT1G26380 FAD-binding Berberine family p... Lus10021289
[exp]
9.2 0.7663
AT4G02780 ATCPS1, ABC33, ... GA REQUIRING 1, CPP synthase, ... Lus10006925
[exp]
14.3 0.6899
AT2G45120 C2H2ZnF C2H2-like zinc finger protein ... Lus10031061
[exp]
15.2 0.7512
AT1G22430 GroES-like zinc-binding dehydr... Lus10004785
[exp]
15.6 0.7780
AT1G66980 GDPDL2, SNC4 Glycerophosphodiester phosphod... Lus10025549
[exp]
18.4 0.6504
AT4G18650 transcription factor-related (... Lus10007282
[exp]
18.7 0.6372
AT3G18080 BGLU44 B-S glucosidase 44 (.1) Lus10041993
[exp]
26.0 0.7068

Lus10040955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.