Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56110 51 / 2e-09 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT2G40380 51 / 2e-09 PRA1.B2 prenylated RAB acceptor 1.B2 (.1) AT2G38360 50 / 2e-09 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT5G05380 49 / 6e-09 PRA1.B3 prenylated RAB acceptor 1.B3 (.1) AT5G01640 48 / 2e-08 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT5G07110 40 / 1e-05 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017425 [exp] 57 / 7e-12 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1) Lus10009842 [exp] 57 / 2e-11 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1) Lus10007533 [exp] 56 / 4e-11 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1) Lus10026404 [exp] 53 / 3e-10 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10042246 [exp] 53 / 4e-10 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10012224 [exp] 53 / 4e-10 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1) Lus10002853 [exp] 53 / 5e-10 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1) Lus10022680 [exp] 49 / 5e-09 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1) Lus10014234 [exp] 48 / 1e-08 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G183300 [exp] 50 / 3e-09 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.008G074000 [exp] 49 / 1e-08 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2) Potri.008G074033 [exp] 49 / 1e-08 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2) Potri.019G124100 [exp] 47 / 4e-08 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.006G104400 [exp] 46 / 1e-07 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.016G126400 [exp] 46 / 1e-07 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.005G054700 [exp] 35 / 0.001 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040958 pacid=23179848 polypeptide=Lus10040958 locus=Lus10040958.g ID=Lus10040958.BGIv1.0 annot-version=v1.0 ATGGCCGGAGTGGCGATTGTGTGTGTCCATGGTGCATTTAGGATCCCCGAAGATCTGTTTCTTGACGAGCAAGAGCCTGCCAGTGCTGGATTACTTTCCT TCCTAGGTGGCGCCGCTTCCTCTGCCGCTGCCGCCGCAGCTCCCGTTGTTGCCGCTGCTCGTGTGTGA
AA sequence Show only first row Show all	>Lus10040958 pacid=23179848 polypeptide=Lus10040958 locus=Lus10040958.g ID=Lus10040958.BGIv1.0 annot-version=v1.0 MAGVAIVCVHGAFRIPEDLFLDEQEPASAGLLSFLGGAASSAAAAAAPVVAAARV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10040958 [exp]	0	1
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10009842 [exp]	2.2	0.9282
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10007533 [exp]	4.5	0.9142
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Lus10037516 [exp]	5.2	0.8949
AT1G79550		PGK	phosphoglycerate kinase (.1.2)		Lus10031167 [exp]	6.9	0.8877
AT1G02840		ATSRP34, SR1, S...	Serine/Arginine-Rich Protein S...		Lus10029885 [exp]	8.1	0.8654
AT5G60570			Galactose oxidase/kelch repeat...		Lus10041299 [exp]	9.2	0.8594
AT3G10410		CPY, SCPL49	CARBOXYPEPTIDASE Y, SERINE CAR...		Lus10038691 [exp]	10.2	0.8631
AT4G09670			Oxidoreductase family protein ...		Lus10013633 [exp]	11.3	0.8687
AT5G11770			NADH-ubiquinone oxidoreductase...		Lus10032157 [exp]	11.8	0.8697
					Lus10042010 [exp]	11.8	0.8456

Compare expression of checked genes

Lus10040958 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.