Lus10040964 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41430 63 / 4e-13 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
AT4G14270 62 / 9e-13 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009847 186 / 9e-62 AT2G41430 63 / 3e-13 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10035419 71 / 2e-16 AT2G41430 113 / 2e-33 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10031029 71 / 2e-16 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10019769 67 / 1e-14 AT2G41430 91 / 1e-23 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10018018 66 / 2e-14 AT2G41430 102 / 8e-29 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10016358 66 / 4e-14 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10042014 64 / 1e-13 AT2G41430 99 / 1e-27 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G074600 123 / 6e-37 AT4G14270 66 / 2e-14 unknown protein
Potri.010G182800 122 / 3e-36 AT4G14270 65 / 6e-14 unknown protein
Potri.016G041600 74 / 3e-17 AT2G41430 121 / 1e-35 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.006G044600 72 / 6e-17 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.001G023100 71 / 6e-16 AT4G14270 89 / 3e-23 unknown protein
Potri.003G202500 71 / 8e-16 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07145 PAM2 Ataxin-2 C-terminal region
Representative CDS sequence
>Lus10040964 pacid=23179552 polypeptide=Lus10040964 locus=Lus10040964.g ID=Lus10040964.BGIv1.0 annot-version=v1.0
ATGGATGTAATGTTTGCCCATAGATCATCATCGTCGACCTTGAATCCAGACGCCCCGCTGTTCGTCCCGATGGCTTACCAGGCGGTGGAGGACTTCTCCG
ATCAGTGGTGGGCCCTCATCCAATCCTCTCCCTGGTTCCGCGACTACTGGCTCCAGGAGCACTACCAAGATCCCCAATCCGATCTTTCCCTCCCCGACGA
TCTCGACTTCTTCGACGACGGCGCCGATTTCCTCCACTTCTCCGGCAAAGATGAGGATGCGAAGAAGGAGGAGGAGGAGGAAGCGAGGCTTAATTGGGAT
GTGATTTCAGTGGGATCGATGAAATGGAAGAAAGGTCAAGCTGATCTGGCTCGGTCGCCGAGGTACTCCGATAAGCCGGCCAAGATTGTGAATTTGAAGA
TGAGTCCAAGGTCAATTCAGCAGCCCAGGTAG
AA sequence
>Lus10040964 pacid=23179552 polypeptide=Lus10040964 locus=Lus10040964.g ID=Lus10040964.BGIv1.0 annot-version=v1.0
MDVMFAHRSSSSTLNPDAPLFVPMAYQAVEDFSDQWWALIQSSPWFRDYWLQEHYQDPQSDLSLPDDLDFFDDGADFLHFSGKDEDAKKEEEEEARLNWD
VISVGSMKWKKGQADLARSPRYSDKPAKIVNLKMSPRSIQQPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10040964 0 1
AT5G05700 ATATE1, DLS1, A... DELAYED LEAF SENESCENCE 1, arg... Lus10004392 1.4 0.8853
AT1G77250 RING/FYVE/PHD-type zinc finger... Lus10042764 4.9 0.8661
AT1G23550 SRO2 similar to RCD one 2 (.1) Lus10030611 4.9 0.8840
AT5G10490 MSL2 MSCS-like 2 (.1.2.3) Lus10002652 6.3 0.8601
AT3G29010 Biotin/lipoate A/B protein lig... Lus10017321 6.5 0.8426
AT2G17020 F-box/RNI-like superfamily pro... Lus10023988 9.0 0.8491
AT3G48530 KING1 SNF1-related protein kinase re... Lus10022458 10.1 0.8761
AT3G52660 RNA-binding (RRM/RBD/RNP motif... Lus10021351 10.7 0.8260
AT3G48530 KING1 SNF1-related protein kinase re... Lus10016763 14.7 0.8560
AT5G63620 GroES-like zinc-binding alcoho... Lus10039625 15.6 0.8466

Lus10040964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.