Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05365 91 / 6e-26 Heavy metal transport/detoxification superfamily protein (.1) AT3G56240 47 / 6e-08 ATX1, CCH copper chaperone (.1) AT1G66240 46 / 9e-08 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT5G19090 45 / 7e-07 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT3G56891 43 / 3e-06 Heavy metal transport/detoxification superfamily protein (.1) AT3G06130 42 / 6e-06 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G27690 42 / 1e-05 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 40 / 2e-05 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT5G02600 40 / 3e-05 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT2G37390 39 / 0.0001 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009848 [exp] 123 / 1e-38 AT5G05365 115 / 2e-35 Heavy metal transport/detoxification superfamily protein (.1) Lus10024435 [exp] 47 / 2e-07 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10043444 [exp] 45 / 2e-07 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3) Lus10025294 [exp] 47 / 3e-07 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10028859 [exp] 46 / 3e-07 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3) Lus10019789 [exp] 45 / 4e-07 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10014120 [exp] 45 / 4e-07 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10040870 [exp] 42 / 7e-06 AT2G28660 110 / 2e-28 Chloroplast-targeted copper chaperone protein (.1) Lus10015174 [exp] 42 / 1e-05 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G182700 [exp] 96 / 8e-27 AT5G05365 86 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G236500 [exp] 52 / 2e-10 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.008G023800 [exp] 48 / 9e-09 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3) Potri.019G106500 [exp] 45 / 3e-07 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 45 / 3e-07 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G132000 [exp] 44 / 2e-06 AT5G27690 114 / 4e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G024700 [exp] 43 / 3e-06 AT5G27690 114 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G206900 [exp] 43 / 5e-06 AT5G27690 111 / 3e-28 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114300 [exp] 42 / 8e-06 AT1G23000 128 / 2e-33 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G026100 [exp] 42 / 1e-05 AT5G27690 100 / 3e-24 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10040965 pacid=23179788 polypeptide=Lus10040965 locus=Lus10040965.g ID=Lus10040965.BGIv1.0 annot-version=v1.0 ATGACTAATGTGGTGGAGCTGAAAGTGGGATTGCACTGTGACGAATGCATCAAGAAGATCCTCAAGGCCATCAAGAAGATACAAGATATTGAAACATACG ACGTGGATACTCAGCTGAACAAGGTCACCGTGACTGGGAACATCACCACTGAACAAGTCATCCGAGTTATCCACAAGATTGGCAAGACTGCATTCACTTG GGACGACGACTCCCAATCCCAACTTAACCAACAGCATCACTTCTGA
AA sequence Show only first row Show all	>Lus10040965 pacid=23179788 polypeptide=Lus10040965 locus=Lus10040965.g ID=Lus10040965.BGIv1.0 annot-version=v1.0 MTNVVELKVGLHCDECIKKILKAIKKIQDIETYDVDTQLNKVTVTGNITTEQVIRVIHKIGKTAFTWDDDSQSQLNQQHHF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05365			Heavy metal transport/detoxifi...		Lus10040965 [exp]	0	1
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Lus10027716 [exp]	2.4	0.9416
AT5G18970			AWPM-19-like family protein (....		Lus10041238 [exp]	4.1	0.9442
AT5G05365			Heavy metal transport/detoxifi...		Lus10009848 [exp]	6.6	0.9152
AT1G73040			Mannose-binding lectin superfa...		Lus10037605 [exp]	7.7	0.9252
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	7.9	0.9421
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10020190 [exp]	9.6	0.9394
					Lus10033890 [exp]	10.2	0.9282
AT2G41110		ACAM-2, ATCAL5,...	calmodulin 2 (.1.2)		Lus10021487 [exp]	11.2	0.9275
AT1G13920			Remorin family protein (.1)		Lus10026649 [exp]	12.0	0.9326
AT3G55740		ATPROT2, ProT2	proline transporter 2 (.1.2)		Lus10040238 [exp]	13.2	0.9026

Compare expression of checked genes

Lus10040965 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.