Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004562 [exp] 52 / 2e-08 AT4G17890 512 / 0.0 ARF-GAP domain 8 (.1.2) Lus10004125 [exp] 0 / 1 AT4G17890 283 / 4e-94 ARF-GAP domain 8 (.1.2) Lus10000903 [exp] 0 / 1 AT4G17890 469 / 3e-165 ARF-GAP domain 8 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G092300 [exp] 63 / 1e-12 AT4G17890 525 / 0.0 ARF-GAP domain 8 (.1.2) Potri.001G142100 [exp] 59 / 3e-11 AT4G17890 535 / 0.0 ARF-GAP domain 8 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040989 pacid=23179631 polypeptide=Lus10040989 locus=Lus10040989.g ID=Lus10040989.BGIv1.0 annot-version=v1.0 ATGGCAACCAGCGATAGCTTCACCCACAAAGATGTTGATTCAGAAGTGCCAGCAAGAAGTCTCTTGGGACAAAGAGAACCGGGAAATCCGGAGGTCTTGG TGTCAGAAAGCTCACTACAAAGTCCAACTTCCAAGTTGCAGCTCAATGAAAATGTGTACTATCAGAAGTCTGAAGAAGCACCTATTCTTGTTCCATCGTC TTCTGAATATGCAGATAATGTGCAGCCTGCAGAAACAGTTTCAGGTGGATCAAAGGTGGTTGCAGACTTGGGAATGGAGAGTGGTTTTCCGGAGAAGGGA AACTCAAATTCATCAAAAGTGCAAGTAATGGTGTACTATTGTCATCCTAAGAAGATATTAACTTAA
AA sequence Show only first row Show all	>Lus10040989 pacid=23179631 polypeptide=Lus10040989 locus=Lus10040989.g ID=Lus10040989.BGIv1.0 annot-version=v1.0 MATSDSFTHKDVDSEVPARSLLGQREPGNPEVLVSESSLQSPTSKLQLNENVYYQKSEEAPILVPSSSEYADNVQPAETVSGGSKVVADLGMESGFPEKG NSNSSKVQVMVYYCHPKKILT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040989 [exp]	0	1
					Lus10000169 [exp]	4.1	0.7856
					Lus10038619 [exp]	6.3	0.7819
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10034380 [exp]	6.6	0.7541
AT4G15020			hAT transposon superfamily (.1...		Lus10002709 [exp]	15.0	0.7395
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10028514 [exp]	17.5	0.7760
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Lus10031387 [exp]	26.7	0.6966
					Lus10007080 [exp]	30.3	0.6729
AT2G46910			Plastid-lipid associated prote...		Lus10000058 [exp]	33.5	0.6832
AT2G45280		ATRAD51C	RAS associated with diabetes p...		Lus10000790 [exp]	36.5	0.6998
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10015190 [exp]	37.3	0.7024

Compare expression of checked genes

Lus10040989 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.