Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21480 90 / 2e-22 STP12 sugar transporter protein 12 (.1) AT1G11260 90 / 2e-22 ATSTP1, STP1 sugar transporter 1 (.1) AT5G23270 85 / 1e-20 ATSTP11, STP11 sugar transporter 11 (.1) AT4G02050 83 / 8e-20 STP7 sugar transporter protein 7 (.1) AT1G34580 76 / 2e-17 Major facilitator superfamily protein (.1) AT3G19940 76 / 2e-17 Major facilitator superfamily protein (.1) AT1G50310 76 / 2e-17 ATSTP9 sugar transporter 9 (.1) AT5G26340 76 / 2e-17 ATSTP13, MSS1, STP13 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) AT1G07340 74 / 9e-17 ATSTP2 sugar transporter 2 (.1) AT5G26250 74 / 1e-16 Major facilitator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013441 [exp] 134 / 2e-38 AT1G50310 731 / 0.0 sugar transporter 9 (.1) Lus10018422 [exp] 88 / 1e-21 AT1G11260 835 / 0.0 sugar transporter 1 (.1) Lus10009656 [exp] 81 / 3e-19 AT5G61520 608 / 0.0 Major facilitator superfamily protein (.1.2) Lus10021924 [exp] 80 / 8e-19 AT5G26340 832 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10041210 [exp] 77 / 1e-17 AT5G26340 236 / 1e-71 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10040991 [exp] 77 / 1e-17 AT3G19940 666 / 0.0 Major facilitator superfamily protein (.1) Lus10009714 [exp] 75 / 5e-17 AT1G77210 329 / 3e-108 sugar transport protein 14, sugar transporter 14 (.1.2) Lus10020934 [exp] 75 / 6e-17 AT1G34580 664 / 0.0 Major facilitator superfamily protein (.1) Lus10022421 [exp] 74 / 8e-17 AT1G77210 790 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G073850 [exp] 101 / 2e-26 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073800 [exp] 101 / 2e-26 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073900 [exp] 100 / 6e-26 AT3G19940 706 / 0.0 Major facilitator superfamily protein (.1) Potri.005G090700 [exp] 93 / 1e-23 AT3G19940 710 / 0.0 Major facilitator superfamily protein (.1) Potri.004G033600 [exp] 87 / 2e-21 AT1G11260 822 / 0.0 sugar transporter 1 (.1) Potri.004G233500 [exp] 86 / 4e-21 AT5G61520 574 / 0.0 Major facilitator superfamily protein (.1.2) Potri.011G042100 [exp] 85 / 1e-20 AT1G11260 808 / 0.0 sugar transporter 1 (.1) Potri.007G072800 [exp] 83 / 7e-20 AT3G19940 672 / 0.0 Major facilitator superfamily protein (.1) Potri.004G101900 [exp] 83 / 7e-20 AT1G11260 625 / 0.0 sugar transporter 1 (.1) Potri.004G101950 [exp] 83 / 7e-20 AT1G11260 625 / 0.0 sugar transporter 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [flax] [poplar] MFS PF00083 [flax] [poplar] Sugar_tr Sugar (and other) transporter
Representative CDS sequence Show only first row Show all	>Lus10040994 pacid=23179807 polypeptide=Lus10040994 locus=Lus10040994.g ID=Lus10040994.BGIv1.0 annot-version=v1.0 ATGGCGGGAGGAGGAGGCCATGTCTCCGAGTACGAAGCAAAACACTACGAAGGCCGGGTCACCGGCTTCGTACTCATCACCTGCGTGGTGGCCGCATTCG GAGGTCTCATCTTTGGATACGACGTCGGTATCTCCGGAGGTGTAACCTCCATGGATTCATTCCTAAGCAAATTCTTCCCGTCCGTTTTCCACAAGGAAAA GAAGGACACCGTGAGAATATGTACTGCAAATTCGATAGCCATCTCCTCACACTCTTCACATCATCCCTTTACCTCGCCGCACTTATCGCTTCCTTTTGCG CCTCCGTAG
AA sequence Show only first row Show all	>Lus10040994 pacid=23179807 polypeptide=Lus10040994 locus=Lus10040994.g ID=Lus10040994.BGIv1.0 annot-version=v1.0 MAGGGGHVSEYEAKHYEGRVTGFVLITCVVAAFGGLIFGYDVGISGGVTSMDSFLSKFFPSVFHKEKKDTVRICTANSIAISSHSSHHPFTSPHLSLPFA PP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21480		STP12	sugar transporter protein 12 (...		Lus10040994 [exp]	0	1
AT3G42880			Leucine-rich repeat protein ki...		Lus10037688 [exp]	9.9	0.9986
AT1G72620			alpha/beta-Hydrolases superfam...		Lus10022106 [exp]	10.7	0.9945
AT5G03810			GDSL-like Lipase/Acylhydrolase...		Lus10008639 [exp]	14.0	0.9986
AT2G44350		CSY4, ATCS	CITRATE SYNTHASE 4, Citrate sy...		Lus10006943 [exp]	17.1	0.9986
AT3G15850		JB67, FADB, ADS...	FATTY ACID DESATURASE B, fatty...		Lus10009469 [exp]	19.8	0.9986
					Lus10014857 [exp]	22.1	0.9986
AT4G22756		ATSMO1-2, ATSMO...	sterol C4-methyl oxidase 1-2 (...		Lus10028908 [exp]	24.2	0.9986
					Lus10004351 [exp]	26.2	0.9986
					Lus10016593 [exp]	28.0	0.9986
AT1G06260			Cysteine proteinases superfami...		Lus10039901 [exp]	28.1	0.9457

Compare expression of checked genes

Lus10040994 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.