Lus10041002 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08410 129 / 2e-38 FTRA2 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
AT5G23440 119 / 8e-35 FTRA1 ferredoxin/thioredoxin reductase subunit A (variable subunit) 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013448 277 / 2e-97 AT5G08410 130 / 5e-39 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G002200 112 / 6e-32 AT5G08410 103 / 3e-28 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Potri.010G255500 103 / 1e-28 AT5G08410 78 / 4e-18 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0610 ETAP PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Representative CDS sequence
>Lus10041002 pacid=23179796 polypeptide=Lus10041002 locus=Lus10041002.g ID=Lus10041002.BGIv1.0 annot-version=v1.0
ATGAGTTTTTGTGCATCCTCCTCCTCCACTGCCGCCGCCGCCGTTCTTGGCCTTCTGCCTTCTCCCCGCCCTACTACTCGAATCCTCCCGCCACTCTCCT
CAACCCATCCTTCTGTTTGGAAGCATAATCGGAAGCTGGTGGTGTCATGCGAAGTGGCCGTCCGGTCATCGAACGAATCCTCCGCCAAATCGGATCCCCA
ACAGCAAGAAGAGCAGCATAAGATTGGAGCGAGGGTGAGGGTGAAGGTGCCGCTGAAGGTGTACCATGTGCCTAAAGTGCCGGAGGTGGATCTGACTGGC
AAAGAAGGCAAGATCAAGCAGTTCGTCGGGGTTTGGAAGGGCAAGCAAATCTCCGCCAATCTCCCTTACAAGGTGGAATTCTTGCTGGACATTGAAGGTC
GAGACGCGCCTGTCAAGCTATTCGCCCATCTCCGGGACGATGAGTTCGAGTACCTTGATTGA
AA sequence
>Lus10041002 pacid=23179796 polypeptide=Lus10041002 locus=Lus10041002.g ID=Lus10041002.BGIv1.0 annot-version=v1.0
MSFCASSSSTAAAAVLGLLPSPRPTTRILPPLSSTHPSVWKHNRKLVVSCEVAVRSSNESSAKSDPQQQEEQHKIGARVRVKVPLKVYHVPKVPEVDLTG
KEGKIKQFVGVWKGKQISANLPYKVEFLLDIEGRDAPVKLFAHLRDDEFEYLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08410 FTRA2 ferredoxin/thioredoxin reducta... Lus10041002 0 1
AT1G22850 SNARE associated Golgi protein... Lus10041062 2.2 0.9278
AT4G32260 PDE334 PIGMENT DEFECTIVE 334, ATPase,... Lus10041039 4.2 0.9370
AT1G77090 Mog1/PsbP/DUF1795-like photosy... Lus10018931 4.9 0.9360
AT3G58070 C2H2ZnF GIS GLABROUS INFLORESCENCE STEMS, ... Lus10016238 5.3 0.9247
AT5G03560 Tetratricopeptide repeat (TPR)... Lus10012049 7.3 0.9085
AT3G01750 Ankyrin repeat family protein ... Lus10036974 8.7 0.8974
AT2G39730 RCA rubisco activase (.1.2.3) Lus10000518 8.9 0.9297
AT3G61180 RING/U-box superfamily protein... Lus10041359 10.7 0.8850
AT5G23140 NCLPP7, NCLPP2,... nuclear-encoded CLP protease P... Lus10040981 11.6 0.9210
AT1G05140 Peptidase M50 family protein (... Lus10027190 11.7 0.9218

Lus10041002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.