Lus10041004 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19120 80 / 4e-17 Eukaryotic aspartyl protease family protein (.1)
AT1G03220 73 / 1e-14 Eukaryotic aspartyl protease family protein (.1)
AT1G03230 72 / 2e-14 Eukaryotic aspartyl protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021939 304 / 1e-102 AT5G19120 228 / 4e-71 Eukaryotic aspartyl protease family protein (.1)
Lus10022958 185 / 5e-59 AT1G03230 78 / 3e-17 Eukaryotic aspartyl protease family protein (.1)
Lus10039217 131 / 1e-38 AT5G19120 78 / 1e-17 Eukaryotic aspartyl protease family protein (.1)
Lus10041224 89 / 5e-20 AT1G03220 527 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10021936 87 / 1e-19 AT1G03220 536 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10041223 85 / 1e-18 AT1G03220 525 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10021938 72 / 2e-14 AT1G03220 501 / 3e-176 Eukaryotic aspartyl protease family protein (.1)
Lus10041226 71 / 8e-14 AT1G03220 382 / 1e-130 Eukaryotic aspartyl protease family protein (.1)
Lus10021937 68 / 4e-13 AT1G03220 347 / 2e-117 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G203100 125 / 1e-33 AT1G03220 280 / 3e-90 Eukaryotic aspartyl protease family protein (.1)
Potri.008G203200 79 / 6e-17 AT1G03220 509 / 6e-180 Eukaryotic aspartyl protease family protein (.1)
Potri.006G068900 76 / 9e-16 AT1G03220 456 / 5e-159 Eukaryotic aspartyl protease family protein (.1)
Potri.002G054900 73 / 1e-14 AT1G03220 544 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065100 49 / 2e-06 AT1G03220 298 / 5e-97 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065200 48 / 3e-06 AT1G03230 303 / 4e-99 Eukaryotic aspartyl protease family protein (.1)
Potri.001G240600 48 / 3e-06 AT1G03230 293 / 4e-95 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065000 46 / 9e-06 AT1G03220 309 / 3e-101 Eukaryotic aspartyl protease family protein (.1)
Potri.019G064800 46 / 1e-05 AT1G03230 290 / 1e-93 Eukaryotic aspartyl protease family protein (.1)
Potri.005G095600 42 / 0.0003 AT1G03220 322 / 3e-106 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence
>Lus10041004 pacid=23179659 polypeptide=Lus10041004 locus=Lus10041004.g ID=Lus10041004.BGIv1.0 annot-version=v1.0
ATGACTTATCTCCCACTTATCATTGTCTTTTGTCTTTCCCTCATTTTCATCCACATCATCCATGCCTCCTCTAATCTCCTTTTACTCCCTGTTGCCAAAG
ATCCCACCAATCACCAGTTCACGACCCTAACCCATCACCGTCTCCAACCCATCAAGCCCGTCGTCGATCTCGGCGGCCCTTCTCTCTGGGTCCACGACTC
ATCATCTCACCACCTTAATCTCCTTCTCCGCTGCTCAATCCAATGCACCAATGCGAATTCCAACGCCGACCATCTTTCTGATAAAACCGCAGCATGCCAT
GTCGAAAACTGTAACGGCATCATCGGGGTTAGATCAAACGGCCAACTCGTGGAAGCCCCCGTCGCCGTCCGATCGATCGACAGGTCAACGGCTACGGTTG
ACTGCTTCATCTTCTCTTGCGGGTCCACATTGATGTGGAATGGCCTGACAAGCGGCGCTCTTGGAATGATCGGATTAGGAGGAAGAAAGAGGCAGATCTC
CCTGACGGCGCAGTTCGCGGCAGCGTTCGGCTTCCGAAGAAGGAGGTTCGTCATCTGCTTCCGAAATTCTGACGTTGGCGTATTGACGTTCGGTGATTCT
CTTGTTGAATCCGTATTCGGAACAGAGATATCAAGGTCTCTGCTTTACACTCCCCTCGTTGCCTCTTCTTCCCCCTCTGACGCCGGATACTTTATCAATC
TGAAGTCGATCATAATTGACGACGAGTATTAG
AA sequence
>Lus10041004 pacid=23179659 polypeptide=Lus10041004 locus=Lus10041004.g ID=Lus10041004.BGIv1.0 annot-version=v1.0
MTYLPLIIVFCLSLIFIHIIHASSNLLLLPVAKDPTNHQFTTLTHHRLQPIKPVVDLGGPSLWVHDSSSHHLNLLLRCSIQCTNANSNADHLSDKTAACH
VENCNGIIGVRSNGQLVEAPVAVRSIDRSTATVDCFIFSCGSTLMWNGLTSGALGMIGLGGRKRQISLTAQFAAAFGFRRRRFVICFRNSDVGVLTFGDS
LVESVFGTEISRSLLYTPLVASSSPSDAGYFINLKSIIIDDEY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19120 Eukaryotic aspartyl protease f... Lus10041004 0 1
AT1G01320 Tetratricopeptide repeat (TPR)... Lus10020453 3.3 0.7217
AT4G23410 TET5 tetraspanin5 (.1) Lus10036518 12.0 0.6785
AT4G35280 C2H2ZnF DAZ2 DUO1-ACTIVATED ZINC FINGER 2, ... Lus10023932 12.5 0.5571
AT1G12920 ERF1-2 eukaryotic release factor 1-2 ... Lus10028313 16.6 0.5853
Lus10011613 21.5 0.6191
AT1G30520 AAE14 acyl-activating enzyme 14 (.1) Lus10009704 24.5 0.6703
AT5G38420 Ribulose bisphosphate carboxyl... Lus10005093 32.9 0.6439
AT3G07360 ATPUB9 ARABIDOPSIS THALIANA PLANT U-B... Lus10024776 33.2 0.6613
AT5G25120 CYP71B11 "ytochrome p450, family 71, su... Lus10023709 34.5 0.6217
AT2G18850 SET domain-containing protein ... Lus10025463 36.3 0.6025

Lus10041004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.