Lus10041006 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08390 167 / 1e-48 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G23430 160 / 3e-46 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT1G11160 159 / 8e-46 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G61210 158 / 2e-45 DWA3 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013452 285 / 1e-89 AT1G50410 1003 / 0.0 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1)
Lus10011224 164 / 2e-47 AT1G11160 665 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10018458 161 / 2e-46 AT1G11160 668 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G002300 245 / 2e-77 AT5G08390 1006 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.010G255400 229 / 4e-72 AT5G08390 927 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.011G045500 157 / 3e-45 AT1G61210 723 / 0.0 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10041006 pacid=23179641 polypeptide=Lus10041006 locus=Lus10041006.g ID=Lus10041006.BGIv1.0 annot-version=v1.0
ATGAAACCTGGGGTGGTTGAGGCTGTCTATAGATATTGGGAACGGAATGATGTCAAGGGCGCGATCAGTGCAATGGAGAAGATGGCTGATCATGCCGTTC
TTGCTGATGTAACCAGTATCATTGCTGAGAAAATTGACATTGTCACGTTGGACATTTGCACATATCTTCTGCCAGTTTTAACGTGTCTTCTCGAGAGCAA
AATTGATCGACATTTGAGCATCTCGATGGATTTGCTGCTGACTTTGGTTCGAACATTTGGGACCATGATCTACACAACTGTATCGGCATCTACCACTGTT
GGTGTAGACATCGAGGCAGAAAGAAGGTTGGAGCGGTGTAATCTTTGCTTTGTAGAGCTAGAAAAGGTGAAGCGTTGCCTGTCTACGTTCACTAGACGAG
GAGGCTCCGTATGGAAGTCTGCACAGGAGTTGAATTTGGCTTTGCAAGAAGTTTCATGA
AA sequence
>Lus10041006 pacid=23179641 polypeptide=Lus10041006 locus=Lus10041006.g ID=Lus10041006.BGIv1.0 annot-version=v1.0
MKPGVVEAVYRYWERNDVKGAISAMEKMADHAVLADVTSIIAEKIDIVTLDICTYLLPVLTCLLESKIDRHLSISMDLLLTLVRTFGTMIYTTVSASTTV
GVDIEAERRLERCNLCFVELEKVKRCLSTFTRRGGSVWKSAQELNLALQEVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11160 Transducin/WD40 repeat-like su... Lus10041006 0 1
AT4G35920 MCA1 mid1-complementing activity 1,... Lus10014256 1.4 0.7782
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10026190 4.8 0.7931
AT1G60860 AGD2 ARF-GAP domain 2 (.1) Lus10030568 8.3 0.7629
AT1G77850 ARF ARF17 auxin response factor 17 (.1) Lus10024754 9.9 0.7026
AT4G28600 NPGR2 no pollen germination related ... Lus10011793 17.8 0.7373
AT1G12430 AtKINUa, ARK3, ... phosphatidic acid kinase, Arab... Lus10006670 18.6 0.7348
AT5G11960 Protein of unknown function (D... Lus10004444 21.9 0.7129
AT1G24460 TNO1 TGN-localized SYP41 interactin... Lus10006252 22.2 0.7181
AT1G03430 AHP5 histidine-containing phosphotr... Lus10003256 23.2 0.6618
AT4G39150 DNAJ heat shock N-terminal dom... Lus10017472 24.0 0.7217

Lus10041006 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.