Lus10041021 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25170 306 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 264 / 6e-90 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 250 / 1e-84 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 262 / 3e-84 unknown protein
AT1G47740 225 / 4e-74 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 209 / 2e-68 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 206 / 2e-67 PPPDE putative thiol peptidase family protein (.1.2)
AT4G25680 88 / 3e-21 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 88 / 4e-21 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 66 / 5e-13 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005341 373 / 2e-133 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10018326 335 / 1e-118 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 329 / 4e-116 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10042454 234 / 8e-78 AT1G80690 265 / 1e-89 PPPDE putative thiol peptidase family protein (.1)
Lus10026215 232 / 5e-77 AT1G80690 265 / 8e-90 PPPDE putative thiol peptidase family protein (.1)
Lus10032708 224 / 3e-74 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 221 / 9e-73 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040485 219 / 2e-72 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Lus10011291 218 / 1e-71 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G261500 327 / 8e-115 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 311 / 5e-109 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 272 / 2e-93 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 267 / 2e-91 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 230 / 1e-76 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 228 / 1e-75 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 224 / 2e-74 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 221 / 4e-73 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 220 / 1e-72 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 206 / 2e-67 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10041021 pacid=23179532 polypeptide=Lus10041021 locus=Lus10041021.g ID=Lus10041021.BGIv1.0 annot-version=v1.0
ATGTGGTGTCGGATGATCCTGCTGCACCCGAAGAAGAAGACTGGTTCTGTACCGGTTTACTTGAATGTTTATGATTTGACTCCGATGAATGGCTATGCAT
ACTGGTTTGGCCTCGGAATTTACCATTCCGGTGTCCAAGTTCATGGAGTGGAGTATGGTTATGGAGCTCATGACCACTCAACAACGGGGATATTTGAGGT
GGAACCTAGGCAGTGCCCTGGTTTCACTTTCAGGAAGTCAATACTCATTGGAAGGACTGATCTTGGTCCCAAGGAAGTTCATTCCATGATGGAGAAACTG
GCACAAGAGTATTCAGGGAATACCTACCATCTTATCACCAAGAACTGCAATCACTTCTGCAATGATGTGTCTCTCAAGTTAACAGGGAAAACAATCCCCA
ACTGGGTCAACCGACTTGCTCGTTTAGGTTTTCTTTGCAACTGTGTGCTGCCAGCAGAACTGAATGGAGCAAAAGTGGGGCAAGTTAGATCAGAAGAGAG
GATGCAGCATGTAGAGAAGAAGAAATTAAGAAGCCGTTCAAGTAGATTTGTATCTGCAACTACACCTTCATTATCAACAAGTGGTTCCAGTTCCGCAAGA
AGAAGTGGTAGGAATTGA
AA sequence
>Lus10041021 pacid=23179532 polypeptide=Lus10041021 locus=Lus10041021.g ID=Lus10041021.BGIv1.0 annot-version=v1.0
MWCRMILLHPKKKTGSVPVYLNVYDLTPMNGYAYWFGLGIYHSGVQVHGVEYGYGAHDHSTTGIFEVEPRQCPGFTFRKSILIGRTDLGPKEVHSMMEKL
AQEYSGNTYHLITKNCNHFCNDVSLKLTGKTIPNWVNRLARLGFLCNCVLPAELNGAKVGQVRSEERMQHVEKKKLRSRSSRFVSATTPSLSTSGSSSAR
RSGRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25170 PPPDE putative thiol peptidase... Lus10041021 0 1
AT1G75800 Pathogenesis-related thaumatin... Lus10033136 5.9 0.7562
AT5G14890 NHL domain-containing protein ... Lus10001932 9.8 0.6626
AT1G05710 bHLH bHLH153 basic helix-loop-helix (bHLH) ... Lus10027064 17.9 0.7216
AT1G29950 bHLH basic helix-loop-helix (bHLH) ... Lus10040879 20.4 0.6848
AT3G15810 Protein of unknown function (D... Lus10038097 26.2 0.6811
AT5G14000 NAC ANAC084 NAC domain containing protein ... Lus10032004 28.9 0.6458
AT5G05820 Nucleotide-sugar transporter f... Lus10016446 33.8 0.6294
AT5G51010 Rubredoxin-like superfamily pr... Lus10022430 40.4 0.6800
AT3G10300 Calcium-binding EF-hand family... Lus10042037 47.5 0.6794
AT1G05710 bHLH bHLH153 basic helix-loop-helix (bHLH) ... Lus10025599 52.2 0.6664

Lus10041021 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.