Lus10041024 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10041024 pacid=23179976 polypeptide=Lus10041024 locus=Lus10041024.g ID=Lus10041024.BGIv1.0 annot-version=v1.0
ATGAGGTCCAACTTGCTTCTCCATTATTCCAAAGTGATCATAGACGACCATAGGAAGGAATTGCCAGTTGGCGCCATTGAAGCAGATCGACCAAGCAACG
CGAGGCAACCTCTGGAAGCCGGCCAGTGGCCAGCCAGTGGTGCTGTATTCATTCGTTTTAGAACATGGCAGTGGATTGATTCGCTAGATTGGGTTATCTT
AAGCTAG
AA sequence
>Lus10041024 pacid=23179976 polypeptide=Lus10041024 locus=Lus10041024.g ID=Lus10041024.BGIv1.0 annot-version=v1.0
MRSNLLLHYSKVIIDDHRKELPVGAIEADRPSNARQPLEAGQWPASGAVFIRFRTWQWIDSLDWVILS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041024 0 1
AT4G03220 Protein with RNI-like/FBD-like... Lus10023567 3.7 0.9973
AT1G04645 Plant self-incompatibility pro... Lus10002219 5.3 0.9973
Lus10005830 6.5 0.9973
AT5G06500 MADS AGL96 AGAMOUS-like 96 (.1) Lus10012154 6.9 0.9513
Lus10009618 7.5 0.9973
AT1G75790 SKS18 SKU5 similar 18 (.1) Lus10013556 8.4 0.9973
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Lus10039085 9.2 0.9973
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Lus10024077 9.9 0.9973
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Lus10028844 10.6 0.9971
Lus10038463 11.2 0.9970

Lus10041024 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.