Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45180 83 / 3e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 82 / 6e-21 ELP extensin-like protein (.1) AT1G62510 79 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 77 / 7e-19 AZI1 azelaic acid induced 1 (.1) AT4G12510 73 / 3e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 73 / 3e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 73 / 4e-17 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46900 72 / 6e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46890 71 / 7e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12500 72 / 9e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006191 [exp] 154 / 1e-49 AT1G62510 103 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001493 [exp] 116 / 1e-34 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002927 [exp] 112 / 9e-33 AT1G62510 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 80 / 6e-20 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 80 / 7e-20 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 79 / 2e-19 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032254 [exp] 78 / 3e-19 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 78 / 4e-19 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032253 [exp] 78 / 5e-19 ND 139 / 2e-43
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G025900 [exp] 101 / 1e-28 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 90 / 3e-24 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 84 / 8e-22 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 83 / 2e-21 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G121900 [exp] 82 / 1e-20 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 81 / 2e-20 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008300 [exp] 76 / 8e-18 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 74 / 2e-17 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.001G121800 [exp] 73 / 2e-17 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G015500 [exp] 71 / 3e-15 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10041036 pacid=23179523 polypeptide=Lus10041036 locus=Lus10041036.g ID=Lus10041036.BGIv1.0 annot-version=v1.0 ATGGCCAAACACCAACTGAGTGCCGTCATTCTGATAGCCAACCTCCTCCTGTTCACCACATTCTCCGCCGCTTGTGTCCCTTGCACCAAACCCAAGCCTC CACCGGCCGCAGCACCGGCGCCGACGCCGCCTGCCAAGTGTCCCAAGGACTATTTGAAGCTAGCGGCATGTGCTGACCTGGTAGGAGGGCTGGCCCACGT AGTGGTGGGGACCCCTCCTTCGAGCAAGTGCTGCTCAGTGCTCAAAGGATTGGCCGACGTGGAATCAGCATTGTGCCTGTGCACAGTCATCAAAGCCAAC GTTCTCAACATTAAACTCACCGTCCCGGTTGCCCTTAGCTTGCTCCTCTCCGCCTGCTCCCTCAACGTCCCTCCCGGCTTCAAATGTTGA
AA sequence Show only first row Show all	>Lus10041036 pacid=23179523 polypeptide=Lus10041036 locus=Lus10041036.g ID=Lus10041036.BGIv1.0 annot-version=v1.0 MAKHQLSAVILIANLLLFTTFSAACVPCTKPKPPPAAAPAPTPPAKCPKDYLKLAACADLVGGLAHVVVGTPPSSKCCSVLKGLADVESALCLCTVIKAN VLNIKLTVPVALSLLLSACSLNVPPGFKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10041036 [exp]	0	1
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Lus10040868 [exp]	2.4	0.9042
AT3G24503		ALDH1A, REF1, A...	REDUCED EPIDERMAL FLUORESCENCE...		Lus10043245 [exp]	3.2	0.8876
AT2G20340			Pyridoxal phosphate (PLP)-depe...		Lus10039740 [exp]	5.7	0.8890
AT3G22840		ELIP1	EARLY LIGHT-INDUCABLE PROTEIN,...		Lus10039378 [exp]	6.0	0.8825
AT1G44575		CP22, PSBS, NPQ...	PHOTOSYSTEM II SUBUNIT S, NONP...		Lus10042720 [exp]	6.7	0.9106
AT3G45070			P-loop containing nucleoside t...		Lus10033719 [exp]	8.4	0.8771
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10005765 [exp]	9.5	0.8708
AT1G42550		PMI1	plastid movement impaired1 (.1...		Lus10039886 [exp]	12.2	0.8883
AT1G42550		PMI1	plastid movement impaired1 (.1...		Lus10002170 [exp]	15.1	0.8724
AT5G49330	MYB	PFG3, ATMYB111	PRODUCTION OF FLAVONOL GLYCOSI...		Lus10016855 [exp]	16.5	0.8428

Compare expression of checked genes

Lus10041036 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.