Lus10041038 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32590 178 / 1e-57 2Fe-2S ferredoxin-like superfamily protein (.1.2.3.4)
AT3G16250 113 / 9e-32 PnsB3, NDF4 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006189 260 / 4e-90 AT4G32590 119 / 8e-35 2Fe-2S ferredoxin-like superfamily protein (.1.2.3.4)
Lus10038292 105 / 3e-28 AT3G16250 227 / 9e-76 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
Lus10025809 104 / 4e-28 AT3G16250 227 / 1e-75 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G247300 189 / 5e-62 AT4G32590 190 / 2e-62 2Fe-2S ferredoxin-like superfamily protein (.1.2.3.4)
Potri.001G186800 93 / 5e-24 AT3G16250 203 / 8e-67 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10041038 pacid=23179969 polypeptide=Lus10041038 locus=Lus10041038.g ID=Lus10041038.BGIv1.0 annot-version=v1.0
ATGTCAGCCATTCATTTCCTCGGCAGCACCCCAATCTCTCATCTGCCCTCCGATTGCTTTTCCCGGCAACGCAACCCCTGCCGGAACCAAGCTGTGAAGC
ACTGTCTCCAAAGCAAAAGGAGATTGTCGTCAGTCTCAGTAACCGCCGACCCGTCGCAGACTGTTCCTGCCGAGAAGCCCGTAATTGAGCTCCACTTCAT
TGGGGCAAAGACAGCAAGTGATGGGAAGTACCCGGTGGAGGAAGCAAGAGCTATAAGTGGAGACAAGCTTCTCAGAAACATTATGCTCGATAATAAAATC
GAGCTGTACGCTACCTATGGGAAACTAATGAACTGTGGAGGTGGTGGAACATGCGGAACCTGCATTGTTGAGATTGTTGAGGGAAATGATCTGCTGAATG
AAAGGACCAATGCTGAATTCCGGTATCTTAAGAAGAAACCAGAATCATGGAGGCTTGCATGCCAGACAATTGTAGGGAATAAAGAAAACTCCGGCAAGGT
TGTGGTTCAGACGCTCCCTCAATGGAAGAAATGA
AA sequence
>Lus10041038 pacid=23179969 polypeptide=Lus10041038 locus=Lus10041038.g ID=Lus10041038.BGIv1.0 annot-version=v1.0
MSAIHFLGSTPISHLPSDCFSRQRNPCRNQAVKHCLQSKRRLSSVSVTADPSQTVPAEKPVIELHFIGAKTASDGKYPVEEARAISGDKLLRNIMLDNKI
ELYATYGKLMNCGGGGTCGTCIVEIVEGNDLLNERTNAEFRYLKKKPESWRLACQTIVGNKENSGKVVVQTLPQWKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10041038 0 1
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10006189 1.0 0.9531
AT2G27290 Protein of unknown function (D... Lus10013320 3.5 0.9341
AT5G07020 proline-rich family protein (.... Lus10024125 4.2 0.9501
AT5G07020 proline-rich family protein (.... Lus10005388 6.2 0.9415
AT3G25805 unknown protein Lus10022435 6.6 0.9355
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Lus10002563 6.7 0.9312
AT5G17670 alpha/beta-Hydrolases superfam... Lus10020326 8.1 0.9349
AT1G29700 Metallo-hydrolase/oxidoreducta... Lus10035042 9.4 0.9292
AT5G57345 unknown protein Lus10001632 10.2 0.9322
AT1G53670 MSRB1, ATMSRB1 methionine sulfoxide reductase... Lus10013727 10.8 0.9280

Lus10041038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.