Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14040 69 / 2e-15 Pectin lyase-like superfamily protein (.1) AT5G48140 67 / 8e-15 Pectin lyase-like superfamily protein (.1) AT3G07850 67 / 1e-14 Pectin lyase-like superfamily protein (.1) AT3G07820 66 / 3e-14 Pectin lyase-like superfamily protein (.1) AT3G07840 65 / 6e-14 Pectin lyase-like superfamily protein (.1) AT3G07830 65 / 7e-14 Pectin lyase-like superfamily protein (.1) AT1G17150 62 / 7e-13 Pectin lyase-like superfamily protein (.1) AT2G33160 62 / 8e-13 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein (.1) AT1G78400 57 / 4e-11 Pectin lyase-like superfamily protein (.1) AT2G41850 57 / 4e-11 ADPG2, PGAZAT ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE 2, polygalacturonase abscission zone A. thaliana (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003001 [exp] 126 / 1e-35 AT3G07840 362 / 1e-118 Pectin lyase-like superfamily protein (.1) Lus10013784 [exp] 70 / 1e-15 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1) Lus10013780 [exp] 70 / 1e-15 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1) Lus10009606 [exp] 69 / 4e-15 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1) Lus10009605 [exp] 69 / 4e-15 AT3G07840 317 / 1e-102 Pectin lyase-like superfamily protein (.1) Lus10039154 [exp] 67 / 1e-14 AT5G48140 335 / 8e-113 Pectin lyase-like superfamily protein (.1) Lus10043087 [exp] 66 / 1e-14 AT3G07840 268 / 4e-89 Pectin lyase-like superfamily protein (.1) Lus10041058 [exp] 64 / 2e-13 AT3G07830 311 / 1e-102 Pectin lyase-like superfamily protein (.1) Lus10041059 [exp] 64 / 2e-13 AT3G07830 310 / 1e-102 Pectin lyase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G067100 [exp] 74 / 3e-17 AT3G07820 404 / 5e-140 Pectin lyase-like superfamily protein (.1) Potri.019G067166 [exp] 74 / 6e-17 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067200 [exp] 74 / 6e-17 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067133 [exp] 74 / 6e-17 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067050 [exp] 70 / 1e-15 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067000 [exp] 70 / 1e-15 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G066800 [exp] 70 / 1e-15 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.009G038100 [exp] 68 / 6e-15 AT1G78400 357 / 4e-121 Pectin lyase-like superfamily protein (.1) Potri.007G035800 [exp] 66 / 5e-14 AT3G07820 350 / 7e-119 Pectin lyase-like superfamily protein (.1) Potri.002G202200 [exp] 62 / 5e-13 AT1G02790 400 / 7e-138 polygalacturonase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF00295 [flax] [poplar] Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence Show only first row Show all	>Lus10041051 pacid=23179820 polypeptide=Lus10041051 locus=Lus10041051.g ID=Lus10041051.BGIv1.0 annot-version=v1.0 ATGGATAATGTTGGCAATCCAATCACAATCGACCAGTTGCCATCAACAGTTGGGATAAGCAAGGTGTTCTTCAAGAATATACATGGGACATCTAGAGATG AACATGCGATCACCATGAATTGTAGTTCAGGAGTACCGTGCAAGGATGTGGATCTTACTTATACAGGACCACGAGGCCCAGCTCAAGCCGTTTGCACCAA TGTCAAGCCAACAATTATTGGCAAGATGAATCCAACCTGTTAA
AA sequence Show only first row Show all	>Lus10041051 pacid=23179820 polypeptide=Lus10041051 locus=Lus10041051.g ID=Lus10041051.BGIv1.0 annot-version=v1.0 MDNVGNPITIDQLPSTVGISKVFFKNIHGTSRDEHAITMNCSSGVPCKDVDLTYTGPRGPAQAVCTNVKPTIIGKMNPTC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14040			Pectin lyase-like superfamily ...		Lus10041051 [exp]	0	1
AT5G25910		AtRLP52	receptor like protein 52 (.1)		Lus10016112 [exp]	7.3	0.6206
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10007110 [exp]	8.2	0.5727
AT5G45840			Leucine-rich repeat protein ki...		Lus10007281 [exp]	16.3	0.5371
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Lus10006141 [exp]	22.0	0.5234
					Lus10010847 [exp]	24.4	0.5664
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10035821 [exp]	27.3	0.5282
					Lus10040835 [exp]	28.6	0.5088
					Lus10014248 [exp]	29.5	0.5397
					Lus10004635 [exp]	67.7	0.4769
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Lus10028210 [exp]	88.3	0.4511

Compare expression of checked genes

Lus10041051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.