Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G33610 67 / 7e-15 Leucine-rich repeat (LRR) family protein (.1) AT1G33600 65 / 3e-14 Leucine-rich repeat (LRR) family protein (.1) AT1G33590 64 / 5e-14 Leucine-rich repeat (LRR) family protein (.1) AT1G33670 63 / 1e-13 Leucine-rich repeat (LRR) family protein (.1) AT2G26380 63 / 1e-13 Leucine-rich repeat (LRR) family protein (.1) AT1G33612 58 / 9e-12 Leucine-rich repeat (LRR) family protein (.1) AT5G23400 43 / 2e-06 Leucine-rich repeat (LRR) family protein (.1) AT5G06870 42 / 3e-06 PGIP2, ATPGIP2 ARABIDOPSIS POLYGALACTURONASE INHIBITING PROTEIN 2, polygalacturonase inhibiting protein 2 (.1) AT3G12145 40 / 2e-05 FLOR1, FLR1 FLOR1, Leucine-rich repeat (LRR) family protein (.1) AT3G08680 40 / 3e-05 Leucine-rich repeat protein kinase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002937 [exp] 71 / 3e-16 AT1G33590 559 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10002936 [exp] 65 / 3e-14 AT1G33590 594 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10002551 [exp] 42 / 4e-06 AT3G20820 476 / 1e-168 Leucine-rich repeat (LRR) family protein (.1) Lus10002753 [exp] 41 / 9e-06 AT2G34930 389 / 2e-120 disease resistance family protein / LRR family protein (.1) Lus10041013 [exp] 41 / 1e-05 AT5G23400 552 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10013454 [exp] 41 / 1e-05 AT5G23400 536 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10041010 [exp] 40 / 2e-05 AT5G23400 557 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Lus10023825 [exp] 40 / 2e-05 AT2G32060 168 / 3e-53 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Lus10016337 [exp] 40 / 2e-05 AT2G34930 471 / 6e-151 disease resistance family protein / LRR family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G098850 [exp] 69 / 1e-15 AT1G33590 629 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Potri.013G098900 [exp] 69 / 1e-15 AT1G33590 582 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Potri.006G058600 [exp] 42 / 6e-06 AT5G06860 383 / 1e-133 polygalacturonase inhibiting protein 1 (.1) Potri.016G049400 [exp] 39 / 4e-05 AT5G06860 372 / 2e-129 polygalacturonase inhibiting protein 1 (.1) Potri.007G001000 [exp] 39 / 5e-05 AT5G23400 642 / 0.0 Leucine-rich repeat (LRR) family protein (.1) Potri.018G074300 [exp] 37 / 0.0002 AT2G26730 550 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.003G207000 [exp] 37 / 0.0003 AT3G20820 488 / 1e-173 Leucine-rich repeat (LRR) family protein (.1) Potri.001G017500 [exp] 37 / 0.0003 AT3G20820 504 / 3e-180 Leucine-rich repeat (LRR) family protein (.1) Potri.016G139200 [exp] 37 / 0.0003 AT5G58300 691 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Potri.009G064300 [exp] 36 / 0.0006 AT3G12610 480 / 8e-171 DNA-DAMAGE REPAIR/TOLERATION 100, Leucine-rich repeat (LRR) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10041065 pacid=23179529 polypeptide=Lus10041065 locus=Lus10041065.g ID=Lus10041065.BGIv1.0 annot-version=v1.0 ATGAAGGATTTGGATTTGTCGAGTAATTCGGTTTTCGGAGGAGTTCCCGGTTGGGTTTCGCGTTTGCAGAGCTTGAATTTGAGCAGGAACCTTCTCTGCG GGAGGATTCCGGCGACCAAGTTTCCGGCGAGCTCGTTTGTAGGGAATAATTGCCTCTGTGGTACACCTTTGCCTGATTGCGGTAAAAAGGGTTAA
AA sequence Show only first row Show all	>Lus10041065 pacid=23179529 polypeptide=Lus10041065 locus=Lus10041065.g ID=Lus10041065.BGIv1.0 annot-version=v1.0 MKDLDLSSNSVFGGVPGWVSRLQSLNLSRNLLCGRIPATKFPASSFVGNNCLCGTPLPDCGKKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G33670			Leucine-rich repeat (LRR) fami...		Lus10041065 [exp]	0	1
AT4G02870			unknown protein		Lus10008543 [exp]	4.2	0.8823
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10016890 [exp]	4.5	0.8920
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10041064 [exp]	4.6	0.9146
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Lus10037283 [exp]	6.3	0.9132
AT4G36360		BGAL3	beta-galactosidase 3 (.1.2)		Lus10020968 [exp]	13.7	0.8770
AT1G11320			unknown protein		Lus10013574 [exp]	14.8	0.9130
AT2G18250		ATCOAD	4-phosphopantetheine adenylylt...		Lus10014296 [exp]	17.2	0.8936
AT5G59613			unknown protein		Lus10005899 [exp]	18.0	0.9053
AT1G76360			Protein kinase superfamily pro...		Lus10012256 [exp]	18.4	0.9032
AT1G18680			HNH endonuclease domain-contai...		Lus10003480 [exp]	20.8	0.8826

Compare expression of checked genes

Lus10041065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.