Lus10041076 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04800 227 / 7e-78 Ribosomal S17 family protein (.1.2.3.4)
AT2G05220 225 / 2e-77 Ribosomal S17 family protein (.1.2)
AT2G04390 224 / 8e-77 Ribosomal S17 family protein (.1)
AT3G10610 219 / 5e-75 Ribosomal S17 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030344 274 / 8e-91 AT1G80560 655 / 0.0 ARABIDOPSIS ISOPROPYLMALATE DEHYDROGENASE 2, isopropylmalate dehydrogenase 2 (.1)
Lus10021307 223 / 3e-76 AT5G04800 231 / 9e-80 Ribosomal S17 family protein (.1.2.3.4)
Lus10004208 219 / 1e-74 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1)
Lus10029412 219 / 1e-74 AT2G04390 233 / 4e-80 Ribosomal S17 family protein (.1)
Lus10016985 142 / 4e-45 AT3G10610 143 / 1e-45 Ribosomal S17 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G241200 223 / 3e-76 AT5G04800 228 / 2e-78 Ribosomal S17 family protein (.1.2.3.4)
Potri.008G017300 222 / 4e-76 AT5G04800 229 / 1e-78 Ribosomal S17 family protein (.1.2.3.4)
Potri.016G073750 169 / 2e-55 AT5G04800 171 / 5e-56 Ribosomal S17 family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00833 Ribosomal_S17e Ribosomal S17
Representative CDS sequence
>Lus10041076 pacid=23179913 polypeptide=Lus10041076 locus=Lus10041076.g ID=Lus10041076.BGIv1.0 annot-version=v1.0
ATGGGACGTGTTCGTACCAAGACCGTGAAGAAATCCTCGCGCCAGGTGATCGAGCGCTACTACTCGAAGATGACACTCGACTTCCACACCAACAAGAAGA
TCCTGGAAGAGGTGGCCATCATCCCCTCGAAGCGCCTCCGCAACAAGATCGCCGGGTTCTCCACCCACCTGATGAAGCGGATCCAGAAGGGCCCCGTTCG
CGGCATCTCCCTCAAGCTTCAGGAGGAGGAGCGCGAACGCCGCATGGACTTCGTCCCGGAACAATCCGCCATCAACATCGACAGGATTGAGGTCGACAAG
GAAACCCTTGAGATGCTCGGCGCACTCGGCATGAGCGGCGTTGAAGGCATCGTCGTAGTGGAACCCGGCACCGTCGCTCCGGTTTACGGGTTTGGCAGAG
GCAGGAGGTTTTGA
AA sequence
>Lus10041076 pacid=23179913 polypeptide=Lus10041076 locus=Lus10041076.g ID=Lus10041076.BGIv1.0 annot-version=v1.0
MGRVRTKTVKKSSRQVIERYYSKMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPEQSAINIDRIEVDK
ETLEMLGALGMSGVEGIVVVEPGTVAPVYGFGRGRRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04800 Ribosomal S17 family protein (... Lus10041076 0 1
AT1G07940 GTP binding Elongation factor ... Lus10023174 2.0 0.9405
AT4G36130 Ribosomal protein L2 family (.... Lus10041923 3.2 0.9499
AT1G74050 Ribosomal protein L6 family pr... Lus10038776 4.6 0.9259
AT5G58420 Ribosomal protein S4 (RPS4A) f... Lus10004272 5.5 0.9397
AT3G05590 RPL18 ribosomal protein L18 (.1) Lus10031485 6.6 0.9315
AT1G18080 RACK1A_AT, ATAR... RECEPTOR FOR ACTIVATED C KINAS... Lus10017569 7.3 0.9231
AT3G57490 Ribosomal protein S5 family pr... Lus10014909 7.4 0.9306
AT4G36130 Ribosomal protein L2 family (.... Lus10028468 8.1 0.9299
AT5G09500 Ribosomal protein S19 family p... Lus10024865 10.5 0.9210
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032918 10.6 0.9258

Lus10041076 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.