Lus10041086 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G12790 434 / 1e-155 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
AT5G22370 172 / 5e-52 QQT1, EMB1705 QUATRE-QUART 1, EMBRYO DEFECTIVE 1705, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT4G21800 81 / 3e-17 QQT2 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036411 540 / 0 AT4G12790 444 / 5e-156 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10018675 187 / 1e-57 AT5G22370 493 / 9e-178 QUATRE-QUART 1, EMBRYO DEFECTIVE 1705, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10007747 181 / 6e-56 AT5G22370 396 / 1e-140 QUATRE-QUART 1, EMBRYO DEFECTIVE 1705, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10019602 82 / 2e-17 AT4G21800 545 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10040022 82 / 3e-17 AT4G21800 542 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G174200 471 / 4e-170 AT4G12790 432 / 5e-155 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Potri.014G015700 184 / 9e-57 AT5G22370 462 / 6e-166 QUATRE-QUART 1, EMBRYO DEFECTIVE 1705, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.010G148000 85 / 1e-18 AT4G21800 555 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.008G103000 84 / 2e-18 AT4G21800 527 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Representative CDS sequence
>Lus10041086 pacid=23179547 polypeptide=Lus10041086 locus=Lus10041086.g ID=Lus10041086.BGIv1.0 annot-version=v1.0
ATGGGCTATGCACAGCTTGTCATTGGCCCCGCTGGCAGCGGGAAGTCCACTTATTGCTCTAGCTTGCACCAACATTGTGAAACCATTGGCCGGTCCATTC
ATATTGTGAACCTAGATCCTGCAGCAGAAAACTTTGACTATCCTGTCGCTGTGGATATTAGAGAGCTCATTAATTTGGATGATGTCATGGAGGAACTTGG
TCTGGGTCCGAATGGTGCTCTTATGTACTGCATGGAGTATCCTTTTAGTTTATACTGTGGCCTTTCTCCTGAACTTGAGGACAACCTGGATGATTGGTTA
ACAGAGGAGCTGGACAACTACATGGATGATGACTACCTAGTTTTTGATTGCCCAGGCCAGATAGAACTCTTTTCACATGTTCCGGTGCTTCGTAACTTTG
TGCAACATTTACAGCGGAAGAATTTCAAAGTTTGTGTTGTATACTTGCTTGATTCACAGTTCATTACAGATGTGACCAAGTTCATTAGTGGCTGTATGGC
ATCCCTCTCTGCAATGGTCCAGCTTGAACTGCCCCATGTTAATATCCTCTCCAAAATGGACCTGGTGAAGAACAAACGGGACCTCGAAGACTACCTCAGG
CCAGAGCCTACAACTCTTTTGGCTGAGCTCAATCAACGCATGGGTCCTCAGTTCTTAAAGCTAAACAAAGCTTTGATTGAACTGGTCGACAGCTACAGTA
TGGTCAGCTTTATGCCACTTGACTTGAGGAAAGAAAGCAGCATTCAGTATGTGCTGTCTCAAATCGATACCGCGATTCAATACGGAGAAGATGCAGACGT
GAAGATCAGAGATTTTGATGAGCCTGAAGATGATGACTAG
AA sequence
>Lus10041086 pacid=23179547 polypeptide=Lus10041086 locus=Lus10041086.g ID=Lus10041086.BGIv1.0 annot-version=v1.0
MGYAQLVIGPAGSGKSTYCSSLHQHCETIGRSIHIVNLDPAAENFDYPVAVDIRELINLDDVMEELGLGPNGALMYCMEYPFSLYCGLSPELEDNLDDWL
TEELDNYMDDDYLVFDCPGQIELFSHVPVLRNFVQHLQRKNFKVCVVYLLDSQFITDVTKFISGCMASLSAMVQLELPHVNILSKMDLVKNKRDLEDYLR
PEPTTLLAELNQRMGPQFLKLNKALIELVDSYSMVSFMPLDLRKESSIQYVLSQIDTAIQYGEDADVKIRDFDEPEDDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G12790 P-loop containing nucleoside t... Lus10041086 0 1
AT4G12790 P-loop containing nucleoside t... Lus10036411 1.4 0.9518
AT1G11340 S-locus lectin protein kinase ... Lus10018406 1.7 0.9403
AT5G10940 ASG2 ALTERED SEED GERMINATION 2, tr... Lus10040538 2.0 0.9353
AT2G43320 S-adenosyl-L-methionine-depend... Lus10015953 2.8 0.9440
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10037630 3.9 0.9288
AT5G43430 ETFBETA electron transfer flavoprotein... Lus10022185 4.2 0.9277
AT5G59140 BTB/POZ domain-containing prot... Lus10040746 4.5 0.9188
AT5G56260 Ribonuclease E inhibitor RraA/... Lus10027126 4.9 0.9257
AT3G16565 alanine-tRNA ligases;nucleic a... Lus10000503 5.5 0.9277
AT3G29170 Eukaryotic protein of unknown ... Lus10028939 8.5 0.8915

Lus10041086 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.