Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04870 0 / 1 AK1, ATCPK1, CPK1 calcium dependent protein kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021248 [exp] 0 / 1 AT3G10660 809 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Lus10013603 [exp] 0 / 1 AT3G10660 803 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Lus10016191 [exp] 0 / 1 AT4G35310 204 / 2e-63 calmodulin-domain protein kinase 5 (.1) Lus10029358 [exp] 0 / 1 AT5G04870 672 / 0.0 calcium dependent protein kinase 1 (.1) Lus10006064 [exp] 0 / 1 AT5G65930 1877 / 0.0 POTATO KINESIN-LIKE CALMODULIN-BINDING PROTEIN, kinesin-like calmodulin-binding protein (ZWICHEL) (.1), kinesin-like calmodulin-binding protein (ZWICHEL) (.2), kinesin-like calmodulin-binding protein (ZWICHEL) (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G244800 [exp] 0 / 1 AT5G04870 899 / 0.0 calcium dependent protein kinase 1 (.1) Potri.008G014700 [exp] 0 / 1 AT5G04870 922 / 0.0 calcium dependent protein kinase 1 (.1) Potri.006G200600 [exp] 0 / 1 AT5G04870 842 / 0.0 calcium dependent protein kinase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041093 pacid=23179651 polypeptide=Lus10041093 locus=Lus10041093.g ID=Lus10041093.BGIv1.0 annot-version=v1.0 ATGAAAACAGAATCAAAGGCACATATTGGCGATTTCACCTGCAAATCTGAGCAGAAACAGTGGAGAAGCAAGATCATCTCTTTGCAGGCTATTCGTACTT TGACAAGGATGGAAGTGGCTAGATTACAACAGATGAGCTTCAACAAGCCTGCAACCGAGTTCGGGATGGAGGCCGTTAATTTGGAAGATATGATCCGAGA AATAGATGAGGATAATGCAAGTGATTTTCATATTTCCTGGAAAGTTGAGTCCTTGCATCATACGGATTACTGCATGATGTGTGATATTTGA
AA sequence Show only first row Show all	>Lus10041093 pacid=23179651 polypeptide=Lus10041093 locus=Lus10041093.g ID=Lus10041093.BGIv1.0 annot-version=v1.0 MKTESKAHIGDFTCKSEQKQWRSKIISLQAIRTLTRMEVARLQQMSFNKPATEFGMEAVNLEDMIREIDEDNASDFHISWKVESLHHTDYCMMCDI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041093 [exp]	0	1
AT1G17350			NADH:ubiquinone oxidoreductase...		Lus10027384 [exp]	1.7	0.9120
AT5G67170			SEC-C motif-containing protein...		Lus10006255 [exp]	2.8	0.9043
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10013996 [exp]	3.0	0.8941
AT1G55340			Protein of unknown function (D...		Lus10010312 [exp]	3.9	0.8829
AT2G45990			unknown protein		Lus10036369 [exp]	5.7	0.8857
AT3G25840			Protein kinase superfamily pro...		Lus10035032 [exp]	6.9	0.8804
AT4G03115			Mitochondrial substrate carrie...		Lus10009777 [exp]	7.5	0.8714
AT2G24960			unknown protein		Lus10026250 [exp]	8.8	0.8642
AT5G40600		EMB1875	unknown protein		Lus10003647 [exp]	11.7	0.8570
AT4G17380		MSH4, ATMSH4	ARABIDOPSIS MUTS HOMOLOG 4, M...		Lus10028966 [exp]	13.6	0.8440

Compare expression of checked genes

Lus10041093 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.