Lus10041105 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16470 153 / 7e-50 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
AT3G02790 153 / 1e-49 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036432 214 / 9e-74 AT3G02790 150 / 9e-49 zinc finger (C2H2 type) family protein (.1)
Lus10026839 167 / 1e-54 AT3G02790 146 / 1e-46 zinc finger (C2H2 type) family protein (.1)
Lus10020216 166 / 2e-54 AT3G02790 146 / 1e-46 zinc finger (C2H2 type) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G053500 165 / 2e-54 AT3G02790 160 / 2e-52 zinc finger (C2H2 type) family protein (.1)
Potri.013G086400 157 / 2e-51 AT3G02790 162 / 1e-53 zinc finger (C2H2 type) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10041105 pacid=23179620 polypeptide=Lus10041105 locus=Lus10041105.g ID=Lus10041105.BGIv1.0 annot-version=v1.0
ATGACTGGAAAAGCGAAGCCGAAGAAGCACACTGCCAAGGAGCTGGCCGCGAAGCTCGACGCTGCTACCACGAACAGGGGCGGAGGCAAAGCCGGAATAG
TAGATAGGACAGGCGGAGAAAAAGGTGGCCATTCCAAATTCGAGTGTCCGCTCTGTAAGGTGACTGCTCCTGACATCAAATCGATGCAGATCCATCACGA
TGCTCGCCATCCTAAGCTTCCCTTCGACGAAGCCAAGTGTTCCAATCTACACGCTACTCTGGTCGCGGCGGCACCTGCCGAAACCTCCTCCTCCTCCGGT
AAGCCGCGTCCTGGAGTCAGGGGCAGCCTCAAGAAGTGA
AA sequence
>Lus10041105 pacid=23179620 polypeptide=Lus10041105 locus=Lus10041105.g ID=Lus10041105.BGIv1.0 annot-version=v1.0
MTGKAKPKKHTAKELAAKLDAATTNRGGGKAGIVDRTGGEKGGHSKFECPLCKVTAPDIKSMQIHHDARHPKLPFDEAKCSNLHATLVAAAPAETSSSSG
KPRPGVRGSLKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02790 C2H2ZnF zinc finger (C2H2 type) family... Lus10041105 0 1
AT2G33730 P-loop containing nucleoside t... Lus10015187 3.2 0.9171
AT2G31670 Stress responsive alpha-beta b... Lus10034659 6.2 0.8912
AT5G47030 ATPase, F1 complex, delta/epsi... Lus10001082 8.4 0.9167
AT1G54140 TAF9, TAFII21 TBP-ASSOCIATED FACTOR 9, TATA ... Lus10012411 10.2 0.8995
AT1G07360 C3HZnF MAC5A MOS4-associated complex subuni... Lus10037244 10.6 0.8946
AT5G20570 HRT1, ROC1, RBX... REGULATOR OF CULLINS-1, RING-b... Lus10037680 12.6 0.8990
AT1G20200 HAP15, EMB2719 HAPLESS 15, EMBRYO DEFECTIVE 2... Lus10034469 13.3 0.9060
AT3G08910 DNAJ heat shock family protein... Lus10005033 13.4 0.8690
AT5G08060 unknown protein Lus10017854 16.5 0.8697
AT5G59950 RNA-binding (RRM/RBD/RNP motif... Lus10025329 19.7 0.8771

Lus10041105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.