Lus10041106 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16490 52 / 1e-08 RIC4 ROP-interactive CRIB motif-containing protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036433 302 / 5e-105 AT5G16490 64 / 1e-12 ROP-interactive CRIB motif-containing protein 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G086600 61 / 1e-11 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.019G053300 59 / 8e-11 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.002G233400 59 / 1e-10 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 51 / 6e-08 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10041106 pacid=23179565 polypeptide=Lus10041106 locus=Lus10041106.g ID=Lus10041106.BGIv1.0 annot-version=v1.0
ATGAGGGCAGGCAGAAGAATGGAGCGCCTGGTACTACTCCCATTCACCATCGGCTGCGTCTCTGAGTCCAGCATCGCCATTGCCAACCATCGCCACATCC
ACCACCCCAGATCGAGATCGAGGCCATCTTCGTCGAATCCTCTTACCACCACCAAGAACAACAATTCCCCTCCACCGTCAACAATCGGAAGGAGGTTAGA
AGACGACGATCATAGCCTATCCAGTAACGACGAAGACACCAAACTGCCCATCAGCAACATATCTGCCGGTTTCCATCGGTTTCTCAAGTCTTTCAAGTCT
ACTTACGTGAACAATGCAGATGACGGGGAAGAAGAAATGGAAGAGGAAGGGATCATGGATATAGGGCTTCCAACAGATGTAAAGCACGTAACCCACATTG
GGTTTGATGATCATGAAGCAATCTCGTCCTCTTCATCGTCGTCAGCATCATTGCTTCCGACCGGTGTCGATCAGCGGCCGCTGATTCTTTGTCAATGCGG
CGGTTGGGAGAATCTGAGTGGTCCACAATCTCATAATCATCATCGCCAGCTCCTCTGTCTTCATCATTCTTCTTTTGTAAGGCCGGAGCAGCTTCCTCTT
GCTTCCCCAGGGGCATCCGATCCAGTACATACAGTCTTTCCCACTTCATCCTGA
AA sequence
>Lus10041106 pacid=23179565 polypeptide=Lus10041106 locus=Lus10041106.g ID=Lus10041106.BGIv1.0 annot-version=v1.0
MRAGRRMERLVLLPFTIGCVSESSIAIANHRHIHHPRSRSRPSSSNPLTTTKNNNSPPPSTIGRRLEDDDHSLSSNDEDTKLPISNISAGFHRFLKSFKS
TYVNNADDGEEEMEEEGIMDIGLPTDVKHVTHIGFDDHEAISSSSSSSASLLPTGVDQRPLILCQCGGWENLSGPQSHNHHRQLLCLHHSSFVRPEQLPL
ASPGASDPVHTVFPTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16490 RIC4 ROP-interactive CRIB motif-con... Lus10041106 0 1
AT5G16490 RIC4 ROP-interactive CRIB motif-con... Lus10036433 1.0 0.9915
AT2G17940 Plant protein of unknown funct... Lus10041916 1.4 0.9863
AT3G18660 PGSIP1, GUX1 glucuronic acid substitution o... Lus10020890 3.5 0.9851
AT2G28315 Nucleotide/sugar transporter f... Lus10041314 5.7 0.9849
AT2G37090 IRX9 IRREGULAR XYLEM 9, Nucleotide-... Lus10026487 6.3 0.9845
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10035517 7.3 0.9832
AT5G37478 TPX2 (targeting protein for Xk... Lus10020800 8.1 0.9759
AT1G11655 unknown protein Lus10020050 8.7 0.9716
AT2G28315 Nucleotide/sugar transporter f... Lus10041315 8.8 0.9815
AT3G61750 Cytochrome b561/ferric reducta... Lus10012625 10.2 0.9786

Lus10041106 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.