Lus10041108 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38670 215 / 1e-70 Pathogenesis-related thaumatin superfamily protein (.1.2.3)
AT2G17860 140 / 8e-42 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75800 140 / 3e-41 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G20030 135 / 3e-39 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT4G36010 132 / 2e-38 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT5G24620 129 / 5e-37 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT4G24180 123 / 3e-35 ATTLP1 THAUMATIN-LIKE PROTEIN 1 (.1)
AT4G36000 118 / 7e-34 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75030 115 / 3e-32 ATLP-3 thaumatin-like protein 3 (.1)
AT1G73620 115 / 4e-32 Pathogenesis-related thaumatin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013560 141 / 1e-41 AT1G75800 173 / 6e-70 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10028448 139 / 8e-41 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041901 138 / 2e-40 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10017265 138 / 4e-40 AT1G75800 390 / 2e-136 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10033136 132 / 4e-38 AT1G75800 375 / 8e-131 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10034534 132 / 5e-38 AT1G75800 376 / 5e-131 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10028447 124 / 8e-35 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041899 122 / 9e-34 AT4G38660 363 / 2e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10031346 115 / 9e-34 AT1G73620 189 / 3e-62 Pathogenesis-related thaumatin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G132200 224 / 8e-74 AT4G38670 410 / 2e-145 Pathogenesis-related thaumatin superfamily protein (.1.2.3)
Potri.005G112700 161 / 2e-49 AT4G36010 372 / 3e-130 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.005G240900 149 / 1e-44 AT1G75800 398 / 7e-140 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.002G020500 147 / 1e-43 AT1G75800 404 / 7e-142 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G241000 127 / 7e-36 AT4G24180 348 / 5e-121 THAUMATIN-LIKE PROTEIN 1 (.1)
Potri.002G020400 124 / 7e-35 AT4G38660 357 / 2e-123 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.005G112600 120 / 2e-33 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.015G000800 119 / 3e-33 AT5G24620 351 / 4e-120 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.004G014574 118 / 5e-33 AT1G75800 294 / 8e-100 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.004G173200 118 / 1e-32 AT4G38660 357 / 5e-123 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Lus10041108 pacid=23179791 polypeptide=Lus10041108 locus=Lus10041108.g ID=Lus10041108.BGIv1.0 annot-version=v1.0
ATGCTCGTTTACCCCAAAAAAGTGACCCGAGGCGGCTGCGGCGCCACCGGGTGTTTGATCGACCTGAACGGCGCGTGCCCTAGGGATTTAAAGGTGATGG
CGCGTGAGAAAGGGAAGGTCGGCGGGGTTGGGTGTAGGAGCGCTTGTGAGGCGTTTGGGGATCCGAGGTTTTGCTGCGCTGGGGCTTATGCCACGCCGGA
GACTTGTGGACCGTCGGATTACTCTCTGTTTTTCAAGTATGCTTGTCCACGGTCATATAGCTACGCTTATGATGATAAGACGAGTACGTATACTTGTGCT
GATACGGATTATGTCATCGTTTTCTGCCCACACCCTTATGCCAGTGAGGAAATTCTGGGGAGAAGGAAAGACGGGGCAGCATTGCCACTGGTAAACAAGA
CAACAATGTACTGGCCTAGCAGACATCCCAATCCCGCTTTCTCTTCAGAGGCGACTACTCTGCCTGTTTCTCTCCTTCAATCCTCCAAGTCAAAAAGAGG
CTGA
AA sequence
>Lus10041108 pacid=23179791 polypeptide=Lus10041108 locus=Lus10041108.g ID=Lus10041108.BGIv1.0 annot-version=v1.0
MLVYPKKVTRGGCGATGCLIDLNGACPRDLKVMAREKGKVGGVGCRSACEAFGDPRFCCAGAYATPETCGPSDYSLFFKYACPRSYSYAYDDKTSTYTCA
DTDYVIVFCPHPYASEEILGRRKDGAALPLVNKTTMYWPSRHPNPAFSSEATTLPVSLLQSSKSKRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G38670 Pathogenesis-related thaumatin... Lus10041108 0 1
AT2G30350 Excinuclease ABC, C subunit, N... Lus10024187 3.5 0.7229
AT1G21980 ATPIPK1, ATPIP5... phosphatidylinositol-4-phospha... Lus10018200 5.1 0.7271
AT4G00550 DGD2 digalactosyl diacylglycerol de... Lus10040927 7.3 0.7312
AT5G04460 RING/U-box superfamily protein... Lus10038656 11.6 0.7253
AT1G14310 Haloacid dehalogenase-like hyd... Lus10036740 13.2 0.7031
AT5G65200 ATPUB38 ARABIDOPSIS THALIANA PLANT U-B... Lus10043464 19.1 0.7212
AT1G80230 Rubredoxin-like superfamily pr... Lus10035917 24.5 0.6752
AT3G08820 Pentatricopeptide repeat (PPR)... Lus10022758 35.3 0.6692
AT4G20740 EMB3131 EMBRYO DEFECTIVE 3131, Pentatr... Lus10016361 50.5 0.6506
AT3G22540 Protein of unknown function (D... Lus10010564 51.2 0.6935

Lus10041108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.