Lus10041112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036438 239 / 5e-82 ND /
Lus10018519 42 / 6e-05 ND /
Lus10039737 42 / 7e-05 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G141600 47 / 7e-07 ND /
Potri.005G204000 46 / 3e-06 ND /
Potri.002G058200 45 / 7e-06 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10041112 pacid=23179845 polypeptide=Lus10041112 locus=Lus10041112.g ID=Lus10041112.BGIv1.0 annot-version=v1.0
ATGGACGCCAAACTAAGACAGTCGGCGTCGTCGACCAAAGTATGCAAGAAAGAGAGGCGAAACGGCTGCAAGTCGTCGTCGTCGTCGTTGAGTTCGACGA
CCACGAGCAGTTTGATGAGCATCCTCCGCCCCAAAGTTTACATCACCGACACTTCAAGCTTCAAGAGCCTCGTCCAGGAGCTCACCGGACGATCAAACTA
TCCCCTGCCGCCGGTATCCGCCGCCGCCACGTCAGCATCGTCGTCCATTCCGAATCTCAGTGAATCCCAAGATTATACCGACCACGTAGAAGGGTCGTCG
TCCGACGTCACTACTGGGACTGGGGCCCATTTCTTCTCTTGCTATGATGATGATGCTGTCGCAGGTGAGGTGGTTATCGGCGGCGCCGGTGAAGGGAGTT
ACGGTGACGTCATGCATGACGGGATGGATCTTTTGACCTACAGGCTGCTGGAGTCGTGGCTTTTGGATACGAATCATCGTGGTAACGATCATGTTGTGAC
GAATTAA
AA sequence
>Lus10041112 pacid=23179845 polypeptide=Lus10041112 locus=Lus10041112.g ID=Lus10041112.BGIv1.0 annot-version=v1.0
MDAKLRQSASSTKVCKKERRNGCKSSSSSLSSTTTSSLMSILRPKVYITDTSSFKSLVQELTGRSNYPLPPVSAAATSASSSIPNLSESQDYTDHVEGSS
SDVTTGTGAHFFSCYDDDAVAGEVVIGGAGEGSYGDVMHDGMDLLTYRLLESWLLDTNHRGNDHVVTN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041112 0 1
AT4G26200 ACS7, ATACS7 1-amino-cyclopropane-1-carboxy... Lus10032695 2.0 0.9181
AT3G46510 ATPUB13 ARABIDOPSIS THALIANA PLANT U-B... Lus10017444 4.2 0.9227
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Lus10032926 10.5 0.9188
AT2G03340 WRKY WRKY3 WRKY DNA-binding protein 3 (.1... Lus10036800 10.7 0.9249
AT1G13550 Protein of unknown function (D... Lus10031914 16.9 0.9040
Lus10012067 17.3 0.9006
AT2G42430 AS2 ASL18, LBD16 ASYMMETRIC LEAVES2-LIKE 18, la... Lus10033872 19.9 0.8922
AT2G14960 GH3.1 Auxin-responsive GH3 family pr... Lus10013887 32.9 0.9101
Lus10011653 34.9 0.9159
AT1G72310 ATL3 RING/U-box superfamily protein... Lus10016427 38.5 0.9176

Lus10041112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.