Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18070 43 / 1e-05 BGLU43 beta glucosidase 43 (.1.2) AT5G48375 43 / 2e-05 BGLU39, TGG3 BETA GLUCOSIDASE 39, thioglucoside glucosidase 3 (.1) AT2G25630 42 / 3e-05 BGLU14 beta glucosidase 14 (.1) AT5G44640 42 / 4e-05 BGLU13 beta glucosidase 13 (.1) AT5G54570 41 / 5e-05 BGLU41 beta glucosidase 41 (.1) AT1G26560 40 / 9e-05 BGLU40 beta glucosidase 40 (.1) AT5G42260 40 / 0.0001 BGLU12 beta glucosidase 12 (.1) AT5G26000 40 / 0.0002 AtTGG1, BGLU38, TGG1 BETA GLUCOSIDASE 38, thioglucoside glucohydrolase 1 (.1.2) AT3G18080 40 / 0.0002 BGLU44 B-S glucosidase 44 (.1) AT3G60130 39 / 0.0002 BGLU16 beta glucosidase 16 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036444 [exp] 144 / 1e-42 AT2G26850 391 / 9e-135 F-box family protein (.1) Lus10036445 [exp] 80 / 1e-18 AT2G44450 506 / 8e-176 beta glucosidase 15 (.1) Lus10020823 [exp] 54 / 2e-09 AT5G42260 383 / 3e-129 beta glucosidase 12 (.1) Lus10031234 [exp] 54 / 2e-09 AT2G44480 563 / 0.0 beta glucosidase 17 (.1.2) Lus10031235 [exp] 51 / 2e-08 AT2G44450 590 / 0.0 beta glucosidase 15 (.1) Lus10008503 [exp] 50 / 4e-08 AT2G44450 489 / 2e-169 beta glucosidase 15 (.1) Lus10031808 [exp] 50 / 4e-08 AT2G44480 560 / 0.0 beta glucosidase 17 (.1.2) Lus10012687 [exp] 50 / 7e-08 AT2G44480 525 / 0.0 beta glucosidase 17 (.1.2) Lus10030576 [exp] 46 / 1e-06 AT2G44480 400 / 6e-136 beta glucosidase 17 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G040700 [exp] 52 / 1e-08 AT5G44640 548 / 0.0 beta glucosidase 13 (.1) Potri.001G226200 [exp] 49 / 8e-08 AT3G60130 302 / 1e-99 beta glucosidase 16 (.1.2.3) Potri.001G015100 [exp] 49 / 1e-07 AT5G44640 553 / 0.0 beta glucosidase 13 (.1) Potri.001G225808 [exp] 49 / 2e-07 AT3G60130 475 / 1e-163 beta glucosidase 16 (.1.2.3) Potri.001G226100 [exp] 48 / 2e-07 AT3G60130 476 / 6e-164 beta glucosidase 16 (.1.2.3) Potri.T085301 [exp] 45 / 3e-06 AT5G44640 575 / 0.0 beta glucosidase 13 (.1) Potri.003G211100 [exp] 45 / 3e-06 AT5G44640 569 / 0.0 beta glucosidase 13 (.1) Potri.008G094200 [exp] 44 / 7e-06 AT1G26560 798 / 0.0 beta glucosidase 40 (.1) Potri.001G409900 [exp] 44 / 8e-06 AT5G54570 791 / 0.0 beta glucosidase 41 (.1) Potri.001G227400 [exp] 42 / 2e-05 AT2G44480 513 / 3e-180 beta glucosidase 17 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041118 pacid=23179819 polypeptide=Lus10041118 locus=Lus10041118.g ID=Lus10041118.BGIv1.0 annot-version=v1.0 ATGAAGCAGAAATGGGTTAAGATCGTTGGTCCTGCTGCTTCCAGAGAGTGGCAGCTATGGCATCACCATCAAGCTGCTAATTCTTCAAAAAAATGGTGGT TGTTGATGAGGGACGTTGCATCGTCTTTGTTTCGGTATCTCCACTCTTGGTTCATCAGTTCGTATCCAGACGACTTTCATCATAAGTGGGCCAATCCCGG ACATCACCGAGGGTACCCCAGAGCGACAAAAACACCCTGTGCGACTCAAAAGGGAGTGATATCAATAGTTTTGAACACAGATTGGTTTATTCCTTACACA GCAAGTAAGGAAGACATTGATGCAGCACAAAGAGCCCTCGGATTTTGCTTGGGATGGTAA
AA sequence Show only first row Show all	>Lus10041118 pacid=23179819 polypeptide=Lus10041118 locus=Lus10041118.g ID=Lus10041118.BGIv1.0 annot-version=v1.0 MKQKWVKIVGPAASREWQLWHHHQAANSSKKWWLLMRDVASSLFRYLHSWFISSYPDDFHHKWANPGHHRGYPRATKTPCATQKGVISIVLNTDWFIPYT ASKEDIDAAQRALGFCLGW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G54570		BGLU41	beta glucosidase 41 (.1)		Lus10041118 [exp]	0	1

Compare expression of checked genes

Lus10041118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.