Lus10041122 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 146 / 6e-40 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 115 / 1e-28 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 112 / 1e-27 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 98 / 2e-22 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61980 90 / 1e-19 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 86 / 5e-18 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 84 / 1e-17 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 83 / 4e-17 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 81 / 9e-17 Mitochondrial transcription termination factor family protein (.1)
AT1G79220 78 / 1e-15 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036450 568 / 0 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10008688 154 / 5e-43 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 142 / 2e-38 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 133 / 3e-35 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 124 / 5e-32 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10004329 119 / 3e-30 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 115 / 1e-28 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10028912 112 / 1e-27 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
Lus10029199 100 / 3e-23 AT5G64950 226 / 1e-70 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034700 154 / 3e-43 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 154 / 7e-43 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034600 152 / 3e-42 AT5G07900 197 / 4e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 145 / 5e-40 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190300 145 / 1e-39 AT5G07900 209 / 8e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 143 / 6e-39 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034500 142 / 9e-39 AT5G07900 208 / 2e-63 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035000 140 / 1e-37 AT5G07900 209 / 7e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.001G029400 139 / 1e-37 AT5G07900 181 / 4e-53 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190700 137 / 5e-37 AT5G07900 213 / 3e-65 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10041122 pacid=23179858 polypeptide=Lus10041122 locus=Lus10041122.g ID=Lus10041122.BGIv1.0 annot-version=v1.0
ATGGCTCTTTCAATCCGCAAGTCTCTCTTGTCATTATATATAAGGTCACCGTCCTTTACCAACACTAGCTCATTCTTCTTCTCAACCCTCAAAACCCCAA
AATCCAAATCCAAATCCAAATCCAAATCCAAAATCTCAGTCTTTGATTACTTAGTCAACCAGCAGAAGTTCTCGCCTGACATAGCCGCCAAAGCCTTATC
AGTCGCAGTCGTGAAGAACCTGAAGAACCCTCAAAACGCCGATTCCGTACTATCATACCTAATCGCCGTCGGATTCTCCCGCTCCCAAATCGAAACTATC
GTCCAAAAGGTCCCCCGAGTCCTCTCCTCCGACGTCGACAACGTTCTAAAACCTAAAGTCGAAGTCTTCTCCGATTCAGGATTAAAACCAAAGGACATGG
CGGAGATCATCACCGGAGATCCATGGATCCTAACCAGAAGCCCAGTCAATAGGTTAGCTCCTTCAATAGAAGCATTAAAGAGCGTAGTCGGATCAGTATC
CGTTGTAGCCTCATTGTTGAAGAAATCCGCTTGGTTCTTAAAACTCGATCTGAACGAAACATTGCTCCCCAACGTCGAATACTTCCAATCGTTAGGACTA
ACTCACGAGAAGATGCTCCGATTCATGTCGAGCTTCCCTCGATTCTTCCTCTTCAAGCCCGAGTTAGTCAAGGAATTCGCTCGAAAGGTCGAAGAGATGG
GATTCGACAAGGAATCCACGATGTTTTTATATGCTGTTCGTGTTGTGAGCTCGATGAGTCCGGAGAAATGGGTGGGCAAGCTGAATCTGCTACGAGAGCT
CGGATTCTCTGAGGAGGATATCGTGTTTGCGTTCAAGAGGCAGCCGATGGCCTTCTCGACATCGGATAGGAAGGTGAAGGAAGTGGTGGAGTTCTTGTTG
AGCGAGACTGATCTCGACATACAGAGCATTGTGAAGTCTCCGCAGTTGCTTCTGTGTAGTATCAAGAATCGGTTTAAGCCGAGGCTGATGGTTATAAAGG
CTTTGCAGGAGAAGAACCTGGTGCGAGAGATTAATATGTGGAATGTTTACAAGTTGGGGCATATTCCGTTCTCGAAGAGGTATGTGTTTCCGTACTGTGA
GAAGGTTGATGGCTTGTTAAGGATAGCTGCTGGGGAATAG
AA sequence
>Lus10041122 pacid=23179858 polypeptide=Lus10041122 locus=Lus10041122.g ID=Lus10041122.BGIv1.0 annot-version=v1.0
MALSIRKSLLSLYIRSPSFTNTSSFFFSTLKTPKSKSKSKSKSKISVFDYLVNQQKFSPDIAAKALSVAVVKNLKNPQNADSVLSYLIAVGFSRSQIETI
VQKVPRVLSSDVDNVLKPKVEVFSDSGLKPKDMAEIITGDPWILTRSPVNRLAPSIEALKSVVGSVSVVASLLKKSAWFLKLDLNETLLPNVEYFQSLGL
THEKMLRFMSSFPRFFLFKPELVKEFARKVEEMGFDKESTMFLYAVRVVSSMSPEKWVGKLNLLRELGFSEEDIVFAFKRQPMAFSTSDRKVKEVVEFLL
SETDLDIQSIVKSPQLLLCSIKNRFKPRLMVIKALQEKNLVREINMWNVYKLGHIPFSKRYVFPYCEKVDGLLRIAAGE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10041122 0 1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032962 2.8 0.9397
AT3G49910 Translation protein SH3-like f... Lus10019283 3.0 0.9410
AT2G17670 Tetratricopeptide repeat (TPR)... Lus10028379 3.0 0.9353
AT5G44500 Small nuclear ribonucleoprotei... Lus10023386 4.9 0.9322
AT5G64950 Mitochondrial transcription te... Lus10004329 5.3 0.9038
AT3G22670 Pentatricopeptide repeat (PPR)... Lus10041193 6.7 0.9141
AT5G06550 unknown protein Lus10029343 7.3 0.9314
AT3G57490 Ribosomal protein S5 family pr... Lus10014909 9.2 0.9287
AT3G02490 Pentatricopeptide repeat (PPR)... Lus10032092 10.0 0.9109
AT3G09630 Ribosomal protein L4/L1 family... Lus10019904 10.2 0.9316

Lus10041122 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.