Gene [FLAX] | FIBexDB

Lus10041136 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT1G17930	38 / 0.0004			Aminotransferase-like, plant mobile domain family protein (.1)
AT2G04865	38 / 0.0004			Aminotransferase-like, plant mobile domain family protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10020970 [exp]	160 / 1e-48	AT1G17930	123 / 2e-30	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10027047 [exp]	151 / 1e-44	AT1G17930	119 / 1e-28	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10001981 [exp]	128 / 5e-38	AT1G17930	61 / 2e-10	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10006913 [exp]	117 / 7e-36	ND	40 / 8e-05
Lus10006165 [exp]	112 / 1e-31	AT5G45260	66 / 5e-12	SENSITIVE TO LOW HUMIDITY 1, RESISTANT TO RALSTONIA SOLANACEARUM 1, ARABIDOPSIS THALIANA WRKY DOMAIN PROTEIN 52, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
Lus10043081 [exp]	105 / 5e-30	AT1G17930	64 / 2e-12	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10005957 [exp]	106 / 4e-29	AT1G48120	75 / 1e-14	hydrolases;protein serine/threonine phosphatases (.1)
Lus10000686 [exp]	98 / 6e-27	AT1G17930	87 / 3e-20	Aminotransferase-like, plant mobile domain family protein (.1)
Lus10025434 [exp]	96 / 6e-27	AT2G04865	49 / 5e-08	Aminotransferase-like, plant mobile domain family protein (.1)

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
		PF10536 [flax] [poplar]	PMD	Plant mobile domain

Representative CDS sequence

Show only first row Show all

>Lus10041136 pacid=23179703 polypeptide=Lus10041136 locus=Lus10041136.g ID=Lus10041136.BGIv1.0 annot-version=v1.0

ATGGGGGATGAGACAACCTATAAGGTATTCTTGTTCTGTCTTATCAGAGCTACTCTGTTCCAGGACAAATCTGCTGATCGATCATGTCTTCTGGGTTGGG

AGTACTTCATGAGTTCGGTCAGTGATGTACCAGAGTACGCTTGGAGTGTTGGTGTGCTAGTTTGGTTGTACCGTGAGCTTGGAAAGGCTAACCGTGTGGA

TGCGAAGGCGATGTCAGGTTGTGTTACATTGCAGTCCTCGATTTATGAGTATTTTCCAAGTGTACAACCTGCCAGGATGGTTCGACTGGAGCATAAGGCA

TGA

AA sequence

Show only first row Show all

>Lus10041136 pacid=23179703 polypeptide=Lus10041136 locus=Lus10041136.g ID=Lus10041136.BGIv1.0 annot-version=v1.0

MGDETTYKVFLFCLIRATLFQDKSADRSCLLGWEYFMSSVSDVPEYAWSVGVLVWLYRELGKANRVDAKAMSGCVTLQSSIYEYFPSVQPARMVRLEHKA

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041136 [exp]	0	1

Lus10041136 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.