Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14450 46 / 2e-07 ATBET12 unknown protein AT3G23170 45 / 2e-07 unknown protein AT1G04330 37 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021878 [exp] 101 / 2e-29 AT4G14450 71 / 6e-17 unknown protein Lus10022200 [exp] 67 / 9e-16 AT4G14450 78 / 1e-19 unknown protein Lus10021208 [exp] 65 / 7e-15 AT4G14450 80 / 2e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G164801 [exp] 62 / 7e-14 AT4G14450 57 / 1e-11 unknown protein Potri.010G073900 [exp] 53 / 3e-10 AT4G14450 56 / 3e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041157 pacid=23179835 polypeptide=Lus10041157 locus=Lus10041157.g ID=Lus10041157.BGIv1.0 annot-version=v1.0 ATGGCCGACAGAAACGGACAGAGCAAGATCTCATCCTCCGCCCAGCAGAGCCGGCTCCAGCGTCGCAGGCCGGCTTCCTTGCAGATAAGCCCCGCGGCAT GGAACGCTCCGATCCCTCTTCTCTCCCCGCTGCAGACCTCTCCCACCGCCGTCGAGATGTCGAGATCGAGAGAGGAGCAGAATCAGAACCAGCAGCGAGG AGGAGGACAGGCGGATAGTAAGTCTGTGGTATTCAAGAGATGGCAGCATCCGGCGGCGCCTTTCTGTTACGAGCCGCCCAAGTTCAAGCCCTCCTTCTTC GTTCCTGTATAG
AA sequence Show only first row Show all	>Lus10041157 pacid=23179835 polypeptide=Lus10041157 locus=Lus10041157.g ID=Lus10041157.BGIv1.0 annot-version=v1.0 MADRNGQSKISSSAQQSRLQRRRPASLQISPAAWNAPIPLLSPLQTSPTAVEMSRSREEQNQNQQRGGGQADSKSVVFKRWQHPAAPFCYEPPKFKPSFF VPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14450		ATBET12	unknown protein		Lus10041157 [exp]	0	1
AT5G17680			disease resistance protein (TI...		Lus10010223 [exp]	1.7	0.8433
AT3G59080			Eukaryotic aspartyl protease f...		Lus10020759 [exp]	4.0	0.8164
AT2G19130			S-locus lectin protein kinase ...		Lus10024348 [exp]	7.0	0.7911
AT2G39650			Protein of unknown function (D...		Lus10040293 [exp]	9.7	0.7978
AT4G39830			Cupredoxin superfamily protein...		Lus10022504 [exp]	10.0	0.7980
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10039344 [exp]	11.2	0.7953
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10021263 [exp]	12.6	0.8018
AT2G26530		AR781	Protein of unknown function (D...		Lus10032766 [exp]	12.7	0.7861
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10030751 [exp]	19.6	0.7423
AT4G11600		LSC803, PHGPX, ...	glutathione peroxidase 6 (.1)		Lus10008022 [exp]	21.0	0.7570

Compare expression of checked genes

Lus10041157 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.