Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021882 [exp] 86 / 5e-21 AT4G14480 501 / 6e-175 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041161 pacid=23179682 polypeptide=Lus10041161 locus=Lus10041161.g ID=Lus10041161.BGIv1.0 annot-version=v1.0 ATGAGTTCGCCGCCAGGTGGGATAGAGGTTGATTCGATCATGGTGGGGAGTTTGGTGGTGTTGAGGAAGAGTTTGTATGAGCAGAGGGAGAAAGTGGTGA ATCTGATTGGGTTGTGGGGAGGGGAACAAGAAGAAGAAGAAGTGAAAGCAGAGAGTACTGAAAAGCTGTGGATGGAGCTGGAGAAGGAGAAACAGAGGAG TTTTGAATTGGAGATGGAGCTTGGATTACTTAAGCTTCTAAAGAGTTGGTAA
AA sequence Show only first row Show all	>Lus10041161 pacid=23179682 polypeptide=Lus10041161 locus=Lus10041161.g ID=Lus10041161.BGIv1.0 annot-version=v1.0 MSSPPGGIEVDSIMVGSLVVLRKSLYEQREKVVNLIGLWGGEQEEEEVKAESTEKLWMELEKEKQRSFELEMELGLLKLLKSW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041161 [exp]	0	1
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10010885 [exp]	3.2	0.9722
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10010545 [exp]	4.7	0.9740
AT4G16120		ATSEB1, COBL7	ARABIDOPSIS THALIANA SEC61 BET...		Lus10025045 [exp]	5.3	0.9680
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10043308 [exp]	5.7	0.9705
AT1G18140		LAC1, ATLAC1	laccase 1 (.1)		Lus10040936 [exp]	6.5	0.9686
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Lus10021029 [exp]	8.5	0.9599
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10008168 [exp]	10.8	0.9568
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10021311 [exp]	13.9	0.9707
AT5G39120			RmlC-like cupins superfamily p...		Lus10006538 [exp]	14.3	0.9701
AT5G16020		GEX3	gamete-expressed 3 (.1)		Lus10003058 [exp]	16.0	0.9419

Compare expression of checked genes

Lus10041161 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.