Lus10041166 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14500 539 / 0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT3G23080 503 / 8e-178 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT1G64720 323 / 1e-107 CP5 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G54170 316 / 9e-104 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G13062 137 / 3e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
AT1G55960 125 / 7e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021883 743 / 0 AT4G14500 605 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10033247 318 / 4e-105 AT1G64720 523 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10032938 316 / 9e-104 AT1G64720 437 / 2e-152 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10008281 249 / 3e-80 AT1G64720 374 / 1e-130 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10033334 115 / 2e-28 AT1G55960 384 / 5e-132 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10034791 95 / 7e-21 AT3G13062 346 / 2e-115 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
Lus10000083 62 / 8e-11 AT3G23080 122 / 6e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10015566 46 / 1e-05 AT1G64720 105 / 5e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G162600 573 / 0 AT4G14500 581 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.010G076500 566 / 0 AT4G14500 571 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.011G151500 350 / 2e-117 AT1G64720 515 / 0.0 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.015G005000 347 / 4e-116 AT1G64720 474 / 1e-166 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.012G021400 338 / 1e-112 AT1G64720 478 / 2e-168 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.001G450100 335 / 2e-111 AT1G64720 489 / 6e-173 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.007G002700 126 / 4e-32 AT3G13062 390 / 5e-134 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
Potri.014G001100 124 / 2e-31 AT3G13062 416 / 3e-144 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10041166 pacid=23179963 polypeptide=Lus10041166 locus=Lus10041166.g ID=Lus10041166.BGIv1.0 annot-version=v1.0
ATGGACGCGGCTTTCTTCTTCGATCTGATGGATTTCTTCAAGGAACCCTCCATCACTGAAACATTCGTCGATATTTTACTCTGCGCCGTCCCCATATGGC
TGGCGGTGATGATCGGTCTCGTCATCGGTTGGTCATGGCGGCCTAGGTGGACCGGATTGGTCTTCCTAGGGTTGCGTAGCAAGTTCAGGTATCTATGGAC
GGTGCCGCCGGGTTTTGGAGCGCGTCGACTCTGGCTAGCTTTCACGGCTCTGTCGGCTTTCTCCGTCTGCCGCACGATCTGGTCCGATTTTAGAGGGAAA
AGGGAAAAATCAGCTGCTGCTGCTGTGGCGGCTGCTTCGTCTCTTTCTCCAGATTCAGCGGCTACAAGCTGCGAGGGATTTTCTCATTCTGCTAGCTCCG
CATGTGAAGAGAGGGAGGAGCTTGTAACAGAGAATGACTTGGAACACCTACTTTTTTTGCTTGAAGGGAAGGATAGTAAAATGGACTGGCAATGTATTAT
GGAAAAGACTCCGCCCAACATGTCATATCAAGCTTGGCGCTATGAACCTCAGACAGGCCCTACTGTACTACGTAGCCGAACTGTGTTTGAGGATGCGACT
CCCGACTTGGTTAAAGATTTCTTCTGGGATGATGAATTCCGGCCTAAATGGGATCCAATGCTTGGATACATCAAGATACTGGATGAATGTCCTTCTACAG
GAATCAGCATTTCTCATTGGATAAAAAAGTTTCCATTTTTCTGTAGTGATAGAGAATACATCATTGGAAGAAGAATATGGGAGGCTGGGAAGTCATACTA
TTGCGTTACCAAGGGGGTGCCATACCCGGGCTTGCAGAAGCGAGACAAGCCAAGACGTGTGGAGCTTTATTTCTCTGGTTGGGTGATTAGGCCTGTTGAA
TCGCGGAAAGGTGATGGGCAAATGTCAGCGTGTGAAGTAATTCTGGTGCATTATGAAGACATGGGTATCCCCAAAGACGTGGCAAAGATAGGAGTCCGTC
ATGGGATGTGGCCAGCCGTGAAGAAACTGCATTCTGGGATGCGATCATACCAGAATGCCAGGAAAGCAGATGCCCCGTTGTCCCGTTGTGCTATAATGGC
CAAGATCACCACAAAAGTAACTCTGGACAAGAACTCTGAATCAGAGGATTCTACGGACGAAGGGGGAATCAAAATCGGATTGGTGGAAGGGAATGAAAGG
CGGAAAGAACATGGAATCGATTGGAAATGGATAGTGTTAGGTGGAGCAGTAGCTGTGGTGTGCGGAGTTCGTTCAGGGGCAATCGCGAAGGCCTTGTTAC
TTGGTGCAGGGCAGAGAATTGCCCGGAGGTGA
AA sequence
>Lus10041166 pacid=23179963 polypeptide=Lus10041166 locus=Lus10041166.g ID=Lus10041166.BGIv1.0 annot-version=v1.0
MDAAFFFDLMDFFKEPSITETFVDILLCAVPIWLAVMIGLVIGWSWRPRWTGLVFLGLRSKFRYLWTVPPGFGARRLWLAFTALSAFSVCRTIWSDFRGK
REKSAAAAVAAASSLSPDSAATSCEGFSHSASSACEEREELVTENDLEHLLFLLEGKDSKMDWQCIMEKTPPNMSYQAWRYEPQTGPTVLRSRTVFEDAT
PDLVKDFFWDDEFRPKWDPMLGYIKILDECPSTGISISHWIKKFPFFCSDREYIIGRRIWEAGKSYYCVTKGVPYPGLQKRDKPRRVELYFSGWVIRPVE
SRKGDGQMSACEVILVHYEDMGIPKDVAKIGVRHGMWPAVKKLHSGMRSYQNARKADAPLSRCAIMAKITTKVTLDKNSESEDSTDEGGIKIGLVEGNER
RKEHGIDWKWIVLGGAVAVVCGVRSGAIAKALLLGAGQRIARR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14500 Polyketide cyclase/dehydrase a... Lus10041166 0 1
AT4G14500 Polyketide cyclase/dehydrase a... Lus10021883 1.0 0.9136
AT1G15140 FAD/NAD(P)-binding oxidoreduct... Lus10007955 2.8 0.8052
AT5G47870 RAD52-2B, RAD52... radiation sensitive 51-2, unkn... Lus10001196 14.4 0.7335
AT4G14600 Target SNARE coiled-coil domai... Lus10041130 17.2 0.7232
AT4G31560 HCF153 high chlorophyll fluorescence ... Lus10039571 24.3 0.7767
AT3G04790 EMB3119 EMBRYO DEFECTIVE 3119, Ribose ... Lus10009181 28.8 0.7710
AT4G09620 Mitochondrial transcription te... Lus10009420 30.3 0.7405
AT5G48545 HINT3 histidine triad nucleotide-bin... Lus10025883 31.2 0.7184
AT1G56300 Chaperone DnaJ-domain superfam... Lus10020685 33.0 0.6653
AT4G26860 Predicted pyridoxal phosphate-... Lus10032558 38.0 0.7655

Lus10041166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.