Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23000 108 / 8e-29 PKS7, ATSRPK1, ATSR2, CIPK7, SnRK3.10 SNF1-RELATED PROTEIN KINASE 3.10, CBL-interacting protein kinase 7 (.1) AT4G14580 104 / 3e-27 CIPK4, SnRK3.3 SNF1-RELATED PROTEIN KINASE 3.3, CBL-interacting protein kinase 4 (.1) AT2G38490 86 / 1e-20 CIPK22, SnRK3.19 SNF1-RELATED PROTEIN KINASE 3.19, CBL-interacting protein kinase 22 (.1) AT5G58380 83 / 2e-19 PKS2, CIPK10, SnRK3.8, SIP1 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) AT5G25110 82 / 6e-19 CIPK25, SnRK3.25 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1) AT5G45820 79 / 4e-18 PKS18, CIPK20, SnRK3.6 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1) AT5G45810 78 / 2e-17 CIPK19, SnRK3.5 SNF1-RELATED PROTEIN KINASE 3.5, CBL-interacting protein kinase 19 (.1) AT1G29230 77 / 2e-17 ATCIPK18, ATWL1, CIPK18, SnRK3.20 SNF1-RELATED PROTEIN KINASE 3.20, WPL4-LIKE 1, CBL-interacting protein kinase 18 (.1) AT1G30270 77 / 3e-17 PKS17, ATCIPK23, SnRK3.23, LKS1, CIPK23 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) AT4G18700 77 / 3e-17 ATWL4, CIPK12, SnRK3.9 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021892 [exp] 182 / 4e-56 AT3G23000 427 / 2e-147 SNF1-RELATED PROTEIN KINASE 3.10, CBL-interacting protein kinase 7 (.1) Lus10006640 [exp] 95 / 2e-23 AT3G23000 283 / 8e-92 SNF1-RELATED PROTEIN KINASE 3.10, CBL-interacting protein kinase 7 (.1) Lus10042229 [exp] 82 / 5e-19 AT5G58380 676 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10009925 [exp] 82 / 1e-18 AT2G30360 553 / 0.0 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1) Lus10025396 [exp] 77 / 1e-18 AT2G34180 198 / 1e-62 SNF1-RELATED PROTEIN KINASE 3.7, WPL4-LIKE 2, CBL-interacting protein kinase 13 (.1) Lus10007283 [exp] 80 / 3e-18 AT5G45820 578 / 0.0 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1) Lus10014163 [exp] 79 / 7e-18 AT5G58380 592 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10022749 [exp] 79 / 7e-18 AT5G58380 598 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Lus10022748 [exp] 79 / 1e-17 AT2G30360 491 / 3e-173 SNF1-RELATED PROTEIN KINASE 3.22, PROTEIN KINASE SOS2-LIKE 5, CBL-INTERACTING PROTEIN KINASE 11, SOS3-interacting protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G079000 [exp] 125 / 4e-35 AT3G23000 402 / 6e-138 SNF1-RELATED PROTEIN KINASE 3.10, CBL-interacting protein kinase 7 (.1) Potri.008G160200 [exp] 123 / 3e-34 AT3G23000 399 / 7e-137 SNF1-RELATED PROTEIN KINASE 3.10, CBL-interacting protein kinase 7 (.1) Potri.013G156000 [exp] 84 / 1e-19 AT5G58380 623 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.019G127500 [exp] 81 / 1e-18 AT5G58380 641 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.006G263500 [exp] 79 / 4e-18 AT5G25110 568 / 0.0 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1) Potri.019G048800 [exp] 79 / 5e-18 AT5G58380 539 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.018G119200 [exp] 79 / 6e-18 AT1G30270 749 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Potri.004G058300 [exp] 79 / 7e-18 AT4G18700 735 / 0.0 SNF1-RELATED PROTEIN KINASE 3.9, WPL4-LIKE 4, CBL-interacting protein kinase 12 (.1) Potri.006G062800 [exp] 78 / 2e-17 AT1G30270 753 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Potri.006G186200 [exp] 77 / 3e-17 AT4G30960 649 / 0.0 SNF1-RELATED PROTEIN KINASE 3.14, CBL-INTERACTING PROTEIN KINASE 6, SOS3-interacting protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10041174 pacid=23179928 polypeptide=Lus10041174 locus=Lus10041174.g ID=Lus10041174.BGIv1.0 annot-version=v1.0 ATGGGGAGGCTGCTCGGCCGGGGAAGCTTCGCCAAGGTGTTCGCCGCACATTCGATCGCTGATGAGAAGGAGGTGGCGATCAAGATCATCGACAAGACGA AGATGGAATCCGTCATGGAGCCGAAAGTAATCGGGGAGATCAAGGCGATGCGGCGCCTCCAGCAGCACCCTCACATCCTCCGCATCCAGGAGGTCCTCGC CACCAAGACTCGGATATGCCTCGTCATGGATCTCGCAATCGGCGGGGACCTCTTCTCCAAGGTGATCAAGCGCGGCCGGATGGGCCGGCGCCCGGGGCCG GGCCCGGGAACGGGGGGAGCGGAAATCTCCAGACGGTATGCGGAACGCCGGCGTTTACAGCTCCTGAGGTATTGTACAGGCGCGGCTACGACGGTGCGAT CGCCGACGCCTGGTCCTGTGGAGTGA
AA sequence Show only first row Show all	>Lus10041174 pacid=23179928 polypeptide=Lus10041174 locus=Lus10041174.g ID=Lus10041174.BGIv1.0 annot-version=v1.0 MGRLLGRGSFAKVFAAHSIADEKEVAIKIIDKTKMESVMEPKVIGEIKAMRRLQQHPHILRIQEVLATKTRICLVMDLAIGGDLFSKVIKRGRMGRRPGP GPGTGGAEISRRYAERRRLQLLRYCTGAATTVRSPTPGPVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23000		PKS7, ATSRPK1, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10041174 [exp]	0	1
AT5G17330		GAD1, GAD	GLUTAMATE DECARBOXYLASE 1, glu...		Lus10028530 [exp]	8.8	0.8180
AT5G53110			RING/U-box superfamily protein...		Lus10003400 [exp]	11.9	0.6930
AT5G53830			VQ motif-containing protein (....		Lus10005543 [exp]	12.2	0.8157
AT3G10980		SAG20, WI12, AT...	PLAC8 family protein (.1)		Lus10017417 [exp]	13.4	0.7894
AT2G26690			Major facilitator superfamily ...		Lus10039782 [exp]	14.3	0.8035
AT1G08960		CCX5, AtCXX5, A...	cation calcium exchanger 5, A...		Lus10004469 [exp]	23.6	0.8005
AT4G30190		PMA2, AHA2	PLASMA MEMBRANE PROTON ATPASE ...		Lus10007948 [exp]	26.1	0.8006
AT1G06475			unknown protein		Lus10015269 [exp]	26.6	0.7769
AT1G60790		TBL2	TRICHOME BIREFRINGENCE-LIKE 2,...		Lus10013035 [exp]	29.7	0.7414
AT3G28917	ZF_HD	MIF2	mini zinc finger 2 (.1)		Lus10033016 [exp]	30.7	0.7877

Compare expression of checked genes

Lus10041174 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.