Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14615 63 / 5e-15 unknown protein AT1G52825 56 / 7e-12 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006639 [exp] 91 / 1e-25 AT4G14615 78 / 7e-21 unknown protein Lus10039402 [exp] 91 / 3e-23 AT1G76390 157 / 4e-39 plant U-box 43, ARM repeat superfamily protein (.1.2) Lus10021896 [exp] 37 / 0.0002 AT4G14615 52 / 7e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G079100 [exp] 60 / 1e-13 AT4G14615 115 / 1e-35 unknown protein Potri.008G160101 [exp] 59 / 3e-13 AT4G14615 118 / 6e-37 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09803 [flax] [poplar] Pet100 Pet100
Representative CDS sequence Show only first row Show all	>Lus10041178 pacid=23179934 polypeptide=Lus10041178 locus=Lus10041178.g ID=Lus10041178.BGIv1.0 annot-version=v1.0 ATGTCGAACGTGGGGTTTTCGAAAGGGGTTCTGGAGGTAGCGAAGTTCGCCGTCTACGTCAGCGTTCCTGTCTTTCTCATGAGCTTCGCCGCCGACACAA AGTTCTTCCGCAAACTAACCGGCAAGGAAGACTATGTAGTGTATCCACCGGAGGCAGAAAGACCACCGTCCCCAGAAGAACTCAGAGAAATGGCACGGCA ATTAGCCCGGGAAAGGAAAGCTCAGTGA
AA sequence Show only first row Show all	>Lus10041178 pacid=23179934 polypeptide=Lus10041178 locus=Lus10041178.g ID=Lus10041178.BGIv1.0 annot-version=v1.0 MSNVGFSKGVLEVAKFAVYVSVPVFLMSFAADTKFFRKLTGKEDYVVYPPEAERPPSPEELREMARQLARERKAQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14615			unknown protein		Lus10041178 [exp]	0	1
AT1G68220			Protein of unknown function (D...		Lus10043484 [exp]	1.0	0.8728
AT2G33845			Nucleic acid-binding, OB-fold-...		Lus10015411 [exp]	2.8	0.8523
AT1G29850			double-stranded DNA-binding fa...		Lus10004540 [exp]	9.8	0.8176
					Lus10024538 [exp]	10.4	0.8097
AT5G49060			Heat shock protein DnaJ, N-ter...		Lus10006515 [exp]	11.0	0.8055
AT4G28440			Nucleic acid-binding, OB-fold-...		Lus10013989 [exp]	11.7	0.8088
AT2G44680		CKB4	casein kinase II beta subunit...		Lus10028161 [exp]	12.4	0.8053
AT4G01260	GeBP		DNA-binding storekeeper protei...		Lus10004772 [exp]	12.6	0.7947
AT3G09860			unknown protein		Lus10001400 [exp]	14.3	0.8093
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10022716 [exp]	14.7	0.7577

Compare expression of checked genes

Lus10041178 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.