Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14640 173 / 2e-57 CAM8, AtCML8 calmodulin-like 8, calmodulin 8 (.1) AT3G22930 171 / 3e-56 CML11 calmodulin-like 11 (.1) AT5G37780 161 / 1e-52 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT1G66410 161 / 1e-52 ACAM-4, CAM4 calmodulin 4 (.1.2) AT2G27030 160 / 1e-52 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT3G56800 160 / 5e-52 ACAM-3, CAM3 calmodulin 3 (.1) AT2G41110 160 / 5e-52 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT3G43810 159 / 1e-51 CAM7 calmodulin 7 (.1) AT5G21274 158 / 3e-51 ACAM-6, CAM6 calmodulin 6 (.1) AT2G41090 103 / 2e-29 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039391 [exp] 191 / 5e-64 AT4G14640 268 / 1e-93 calmodulin-like 8, calmodulin 8 (.1) Lus10041288 [exp] 159 / 1e-51 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10037423 [exp] 159 / 1e-51 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 159 / 1e-51 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10027283 [exp] 159 / 1e-51 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10022589 [exp] 159 / 1e-51 AT3G43810 255 / 2e-88 calmodulin 7 (.1) Lus10001775 [exp] 136 / 2e-42 AT2G27030 192 / 1e-63 calmodulin 5 (.1.2.3) Lus10009176 [exp] 130 / 7e-40 AT2G27030 186 / 3e-61 calmodulin 5 (.1.2.3) Lus10021487 [exp] 129 / 7e-40 AT2G41110 255 / 1e-88 calmodulin 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G159300 [exp] 180 / 7e-60 AT3G22930 235 / 1e-80 calmodulin-like 11 (.1) Potri.010G080900 [exp] 179 / 1e-59 AT4G14640 270 / 2e-94 calmodulin-like 8, calmodulin 8 (.1) Potri.012G041000 [exp] 160 / 2e-52 AT5G37780 283 / 9e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.005G052800 [exp] 160 / 4e-52 AT4G14640 228 / 7e-78 calmodulin-like 8, calmodulin 8 (.1) Potri.015G032600 [exp] 160 / 5e-52 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.006G026700 [exp] 159 / 1e-51 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.009G021500 [exp] 159 / 1e-51 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.016G024700 [exp] 159 / 1e-51 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.001G222200 [exp] 160 / 2e-51 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3) Potri.013G040300 [exp] 149 / 7e-48 AT3G22930 210 / 1e-70 calmodulin-like 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10041179 pacid=23179693 polypeptide=Lus10041179 locus=Lus10041179.g ID=Lus10041179.BGIv1.0 annot-version=v1.0 ATGATCACAGAGGTTGATGCTGACGGCAACGGGACCATTGAGTTTGCTGAGTTCTTATGCCTCATGGCCAAGAAGTTCAAGGAGAGTGATGCAGAGGAAG AACTCAAAGAGGCTTTCAAAGTCTTCGATAAGGATCAGAACGGCTACATTTCTGCTACTGAGTTGAGGCATGTAATGATCAACTTAGGAGAAAAGTTGAC TGACGAAGAGGTGGAGCAGATGATCAAGGAGGCTGACTTGGACGGTGATGGTCAAGTTAACTATGATGAATTCGTCAAGATGATGTCCACCGTTGGATGA
AA sequence Show only first row Show all	>Lus10041179 pacid=23179693 polypeptide=Lus10041179 locus=Lus10041179.g ID=Lus10041179.BGIv1.0 annot-version=v1.0 MITEVDADGNGTIEFAEFLCLMAKKFKESDAEEELKEAFKVFDKDQNGYISATELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYDEFVKMMSTVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14640		CAM8, AtCML8	calmodulin-like 8, calmodulin ...		Lus10041179 [exp]	0	1
AT4G35160			O-methyltransferase family pro...		Lus10001510 [exp]	2.0	0.8641
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10029438 [exp]	2.4	0.8656
AT2G47485			unknown protein		Lus10028487 [exp]	4.2	0.8635
AT1G75450		ATCKX6, ATCKX5,...	CYTOKININ OXIDASE 6, ARABIDOPS...		Lus10024289 [exp]	4.5	0.7683
AT4G17486			PPPDE putative thiol peptidase...		Lus10043293 [exp]	6.5	0.8287
AT2G31305		INH3	inhibitor-3 (.1)		Lus10022410 [exp]	8.1	0.7468
AT3G14110		FLU	FLUORESCENT IN BLUE LIGHT, Tet...		Lus10037686 [exp]	8.4	0.7846
AT5G50175			unknown protein		Lus10019469 [exp]	8.4	0.8278
AT5G50175			unknown protein		Lus10043318 [exp]	8.9	0.8289
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10017495 [exp]	14.3	0.7359

Compare expression of checked genes

Lus10041179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.