Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041183 pacid=23180043 polypeptide=Lus10041183 locus=Lus10041183.g ID=Lus10041183.BGIv1.0 annot-version=v1.0 ATGGTCGACGAAGAACAGGCTGCATGTGGATTCCAGAGTCAGAGCAAAGTTCCTGCATCTTCTTGGAGTGGGGACGCTGTGCCTGTGGCTGTTGTACCAG AAGCAGGTGTTCCCGTTGAGGTTGTACCCCAACAAGAAGTCGAAGCTGCTGACAATGGAGTTGCTGCTGGTAATGGACCAGTTCCTGGACCTGATGGTCA AACTTGA
AA sequence Show only first row Show all	>Lus10041183 pacid=23180043 polypeptide=Lus10041183 locus=Lus10041183.g ID=Lus10041183.BGIv1.0 annot-version=v1.0 MVDEEQAACGFQSQSKVPASSWSGDAVPVAVVPEAGVPVEVVPQQEVEAADNGVAAGNGPVPGPDGQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041183 [exp]	0	1
AT3G56930			DHHC-type zinc finger family p...		Lus10010447 [exp]	8.8	0.8051
AT4G37280			MRG family protein (.1)		Lus10019312 [exp]	14.7	0.7707
AT3G52190		AtPHF1, PHF1	phosphate transporter traffic ...		Lus10038651 [exp]	16.1	0.8429
AT5G44440			FAD-binding Berberine family p...		Lus10039682 [exp]	29.2	0.8086
AT1G03430		AHP5	histidine-containing phosphotr...		Lus10027965 [exp]	29.5	0.7657
AT3G56960		PIP5K4	phosphatidyl inositol monophos...		Lus10010458 [exp]	30.3	0.7197
AT3G14460			LRR and NB-ARC domains-contain...		Lus10029705 [exp]	37.9	0.7618
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10040115 [exp]	39.0	0.7724
AT1G74320			Protein kinase superfamily pro...		Lus10024127 [exp]	39.2	0.7458
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10031231 [exp]	51.2	0.7243

Compare expression of checked genes

Lus10041183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.