Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14723 102 / 1e-29 EPFL4, CLL2 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein AT3G22820 99 / 2e-28 EPFL5, CLL1 epidermal patterning factor like 5, CHALLAH-LIKE 1, allergen-related (.1) AT2G30370 89 / 1e-23 EPFL6, CHAL EPF1-like 6, CHALLAH, allergen-related (.1.2) AT3G13898 46 / 2e-07 unknown protein AT1G80133 44 / 1e-06 unknown protein AT4G37810 40 / 4e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021901 [exp] 134 / 2e-42 AT4G14723 104 / 2e-30 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Lus10006616 [exp] 105 / 2e-31 AT4G14723 99 / 5e-29 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Lus10024189 [exp] 81 / 3e-21 ND 107 / 4e-31 Lus10008387 [exp] 53 / 5e-10 AT3G13898 76 / 9e-19 unknown protein Lus10006016 [exp] 53 / 2e-09 AT3G13898 76 / 4e-17 unknown protein Lus10011591 [exp] 47 / 1e-07 AT4G37810 102 / 6e-29 unknown protein Lus10035922 [exp] 41 / 1e-05 AT5G10310 100 / 2e-28 unknown protein Lus10019254 [exp] 40 / 4e-05 AT4G37810 74 / 5e-18 unknown protein Lus10011570 [exp] 39 / 0.0001 AT4G37810 79 / 8e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G157300 [exp] 101 / 4e-29 AT4G14723 69 / 4e-16 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Potri.013G155500 [exp] 94 / 5e-26 AT2G30370 93 / 7e-25 EPF1-like 6, CHALLAH, allergen-related (.1.2) Potri.019G128200 [exp] 91 / 1e-24 AT2G30370 110 / 7e-32 EPF1-like 6, CHALLAH, allergen-related (.1.2) Potri.010G082200 [exp] 74 / 4e-18 AT4G14723 71 / 1e-16 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Potri.003G042300 [exp] 50 / 9e-09 AT3G13898 80 / 4e-20 unknown protein Potri.018G130700 [exp] 43 / 2e-06 AT1G80133 62 / 1e-13 unknown protein Potri.002G112900 [exp] 42 / 1e-05 AT4G37810 90 / 9e-24 unknown protein Potri.007G095400 [exp] 40 / 5e-05 AT5G10310 105 / 2e-30 unknown protein Potri.005G073700 [exp] 38 / 0.0002 AT5G10310 102 / 7e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041186 pacid=23179593 polypeptide=Lus10041186 locus=Lus10041186.g ID=Lus10041186.BGIv1.0 annot-version=v1.0 ATGGCCGTGCCCTGCCGCCAAAACAGTCACTCACCCTCCGTCGTGATCGCCGCGGCCGCCGCCTTCTTCACCTTCCTCTTCTTCTCTTTCTTCACCACCA CCACTCTTGCCCATCTTGGTAGCAGTCAGGGGAAGGAACATTTGATGAACCAGAAGCGGTTGGCTGGACCGGGTTCGTGGCCGCCGACTTGCAGATCAAA ATGCGGGGGTTGCGGTCCTTGCAAACCGGTCCACGTCCCGGTTCATCCAGGGGTTAGCTTCACATTGGAGTACTACCCGGAAGCTTGGCGATGCAAGTGC GGGAACAAGCTCTTTATGCCCTGA
AA sequence Show only first row Show all	>Lus10041186 pacid=23179593 polypeptide=Lus10041186 locus=Lus10041186.g ID=Lus10041186.BGIv1.0 annot-version=v1.0 MAVPCRQNSHSPSVVIAAAAAFFTFLFFSFFTTTTLAHLGSSQGKEHLMNQKRLAGPGSWPPTCRSKCGGCGPCKPVHVPVHPGVSFTLEYYPEAWRCKC GNKLFMP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Lus10041186 [exp]	0	1
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Lus10021901 [exp]	1.7	0.8944
AT1G73820			Ssu72-like family protein (.1)		Lus10024545 [exp]	3.5	0.8575
AT1G21600		PTAC6	plastid transcriptionally acti...		Lus10028562 [exp]	4.9	0.8932
AT1G62760			Plant invertase/pectin methyle...		Lus10031132 [exp]	7.2	0.8648
AT5G20950			Glycosyl hydrolase family prot...		Lus10010657 [exp]	10.4	0.8383
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10012652 [exp]	11.4	0.8656
AT5G64130			cAMP-regulated phosphoprotein ...		Lus10009146 [exp]	12.2	0.7612
AT1G21600		PTAC6	plastid transcriptionally acti...		Lus10018866 [exp]	20.0	0.8618
AT2G11890			adenylate cyclases (.1.2)		Lus10002992 [exp]	20.7	0.8428
AT5G52420			unknown protein		Lus10039249 [exp]	21.0	0.8004

Compare expression of checked genes

Lus10041186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.