Lus10041189 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04190 501 / 3e-180 TPR3 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G62740 100 / 4e-23 Hop2 Hop2, stress-inducible protein, putative (.1)
AT4G12400 94 / 3e-21 Hop3 Hop3, stress-inducible protein, putative (.1.2)
AT1G12270 93 / 9e-21 Hop1 Hop1, stress-inducible protein, putative (.1)
AT3G04710 86 / 3e-18 TPR10 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
AT2G42810 79 / 4e-16 AtPP5, PP5.2, PP5, PAPP5 Arabidopsis thaliana protein phosphatase 5, protein phosphatase 5.2 (.1.2)
AT5G09420 73 / 4e-14 MTOM64, ATTOC64-V, AtmtOM64 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1)
AT4G08320 71 / 2e-13 TPR8 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G53300 71 / 3e-13 TTL1 tetratricopetide-repeat thioredoxin-like 1 (.1)
AT3G17970 69 / 8e-13 ATTOC64-III translocon at the outer membrane of chloroplasts 64-III (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021905 623 / 0 AT1G04190 515 / 0.0 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004336 92 / 3e-20 AT1G62740 873 / 0.0 Hop2, stress-inducible protein, putative (.1)
Lus10024597 91 / 5e-20 AT1G62740 886 / 0.0 Hop2, stress-inducible protein, putative (.1)
Lus10032234 91 / 6e-20 AT1G62740 892 / 0.0 Hop2, stress-inducible protein, putative (.1)
Lus10028919 89 / 3e-19 AT1G62740 890 / 0.0 Hop2, stress-inducible protein, putative (.1)
Lus10042001 82 / 4e-17 AT3G17970 714 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1)
Lus10006559 81 / 2e-16 AT3G04710 581 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
Lus10009682 81 / 2e-16 AT3G17970 700 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1)
Lus10003260 80 / 2e-16 AT3G04710 587 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G082900 543 / 0 AT1G04190 540 / 0.0 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G156500 534 / 0 AT1G04190 540 / 0.0 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G119500 97 / 3e-22 AT4G12400 864 / 0.0 Hop3, stress-inducible protein, putative (.1.2)
Potri.003G113400 96 / 1e-21 AT4G12400 830 / 0.0 Hop3, stress-inducible protein, putative (.1.2)
Potri.013G042300 90 / 6e-20 AT3G04710 619 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
Potri.005G054800 86 / 2e-18 AT3G04710 611 / 0.0 tetratricopeptide repeat 10, ankyrin repeat family protein (.1.2.3)
Potri.012G046900 82 / 4e-17 AT3G17970 744 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1)
Potri.015G038600 81 / 1e-16 AT3G17970 747 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1)
Potri.001G205300 77 / 3e-15 AT5G09420 724 / 0.0 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1)
Potri.014G141800 76 / 5e-15 AT2G42810 895 / 0.0 Arabidopsis thaliana protein phosphatase 5, protein phosphatase 5.2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF00515 TPR_1 Tetratricopeptide repeat
Representative CDS sequence
>Lus10041189 pacid=23179842 polypeptide=Lus10041189 locus=Lus10041189.g ID=Lus10041189.BGIv1.0 annot-version=v1.0
ATGGCGGAAACAGCTCGAGGATCGGCTACAAATGGAACCCAGATGTCATTGAAAGATCAGGGGAACGAATTCTTCAAAGCCGGAAACTTCCTCAAAGCTG
CTGCTGTCTACACCCAGGCTATCAAGCTCGACCCTTCTAATCCGACTCTATATAGTAATCGTGCTGCTGCGTTTGTGCAACTGGTTAAGCTGAATAAAGC
ACTTGCTGATGCTGAGACCACTATCAAACTCAACCCACAGTGGGAGAAGGGTTATTTCAGGAAAGGGTGTGTATTGGAGGTCATGGAACGGTATGATGAT
GCCTTGGAATCCTTCCAAGAAGCTTTACAGTACAACCCACAAAGTGCAGAAGTATCTAGAAAGATTAAGAGGATAACTCAATTAGCAAGGGACAAAAAGA
GAGCTCAAGAGGTGGAGAGCATGAGATCAAATATTGATATCGCAAAGCACTTGAATCAGTTTAAAGCTGAAATGTCAGGGAAGCTTGAATCTGAAGAATT
GGAGAAAGAAGTGTTCTCTTTCATTGTTGATACAATGGAGACAGCTGTTAAGTCATGGCATGAAACTTCTAAAGTGGATCCAAGAGTCTTCTTTCTTTTG
GATAAGGAAAAGACACAAACTGATAAATATGCTCCAATGGTCAACATTGACAAGGCCTTTGAATCACCTCATACACACAGCAATTGCTTCTCATTCCTAA
GGCAGTATGCCGAAGAATCATACTCCAAAGCAGCTTGCTTAATTGTGGCCAAGAATATCATAGCTTACCCGCAGGTTTGGAAAGGTCAAGGATCAAGGAA
GTGGAAGCATGGCCAACTTGATGGCTTCTTCGTTCAGTTCGAGTCACCAACTTCGCGGCAATTGTGGTTTGTCGCTAGCACAACCGAAAGAGGGAAAACA
CTGTGCAGTGACCCAGAGAGCCTAGATATCAGTACACATGAAGTCATCCCGCGAATTTTCAAAGAGAAGTTGAGCACTTCCTAG
AA sequence
>Lus10041189 pacid=23179842 polypeptide=Lus10041189 locus=Lus10041189.g ID=Lus10041189.BGIv1.0 annot-version=v1.0
MAETARGSATNGTQMSLKDQGNEFFKAGNFLKAAAVYTQAIKLDPSNPTLYSNRAAAFVQLVKLNKALADAETTIKLNPQWEKGYFRKGCVLEVMERYDD
ALESFQEALQYNPQSAEVSRKIKRITQLARDKKRAQEVESMRSNIDIAKHLNQFKAEMSGKLESEELEKEVFSFIVDTMETAVKSWHETSKVDPRVFFLL
DKEKTQTDKYAPMVNIDKAFESPHTHSNCFSFLRQYAEESYSKAACLIVAKNIIAYPQVWKGQGSRKWKHGQLDGFFVQFESPTSRQLWFVASTTERGKT
LCSDPESLDISTHEVIPRIFKEKLSTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04190 TPR3 tetratricopeptide repeat 3, Te... Lus10041189 0 1
AT1G04190 TPR3 tetratricopeptide repeat 3, Te... Lus10021905 1.0 0.9132
AT5G27470 seryl-tRNA synthetase / serine... Lus10010211 2.0 0.8415
AT5G05780 RPN8A, AE3, ATH... ASYMMETRIC LEAVES ENHANCER 3, ... Lus10035522 4.0 0.8132
AT4G24820 26S proteasome, regulatory sub... Lus10027348 4.6 0.8343
AT5G02610 Ribosomal L29 family protein ... Lus10025292 9.6 0.8222
AT2G19730 Ribosomal L28e protein family ... Lus10006869 10.1 0.8188
AT1G09000 MAPKKK1, ANP1 MAP KINASE KINASE KINASE 1, NP... Lus10031506 10.7 0.7852
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10016432 10.7 0.8189
AT1G48050 KU80, ATKU80 ARABIDOPSIS THALIANA KU80 HOMO... Lus10009294 11.7 0.7925
AT3G27430 PBB1 N-terminal nucleophile aminohy... Lus10032102 12.7 0.7894

Lus10041189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.