Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22630 362 / 2e-129 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT4G14800 357 / 2e-127 PBD2 20S proteasome beta subunit D2 (.1.2) AT3G14290 66 / 6e-13 PAE2 20S proteasome alpha subunit E2 (.1) AT1G53850 65 / 1e-12 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT1G13060 51 / 7e-08 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G26340 51 / 8e-08 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT3G60820 51 / 9e-08 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 48 / 1e-06 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 48 / 1e-06 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G56450 43 / 5e-05 PBG1 20S proteasome beta subunit G1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021909 [exp] 414 / 4e-150 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1) Lus10039351 [exp] 392 / 2e-141 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10006596 [exp] 184 / 1e-60 AT3G22630 168 / 2e-54 20S proteasome beta subunit D1 (.1) Lus10020180 [exp] 67 / 2e-13 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10026984 [exp] 67 / 3e-13 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10003936 [exp] 64 / 1e-11 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10037454 [exp] 63 / 1e-11 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10006426 [exp] 52 / 4e-08 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10011369 [exp] 51 / 1e-07 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G084800 [exp] 369 / 7e-132 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1) Potri.008G155500 [exp] 368 / 8e-132 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1) Potri.006G077900 [exp] 66 / 3e-13 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.018G145900 [exp] 64 / 3e-12 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.001G162900 [exp] 64 / 3e-12 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 60 / 6e-11 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.014G069800 [exp] 55 / 3e-09 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.008G177000 [exp] 53 / 2e-08 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.002G148300 [exp] 52 / 3e-08 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.010G058100 [exp] 49 / 4e-07 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10041194 pacid=23180022 polypeptide=Lus10041194 locus=Lus10041194.g ID=Lus10041194.BGIv1.0 annot-version=v1.0 ATGGAGTGCGTATTTGGGTTAGTAGGAAACGATTTCGCAATAGTTGCGGCAGATACGTCGGCCGTCCACAGCATTCTGGTCCACAAATCCAACGAGGACA AGATCATGCTCCTCGACTCCCACAAGCTCGTCGCCGCCAGCGGCGAGCCCGGCGACAGAGTTCAATTCACGGAGTACATCCAGAAGAACGTGACTTTGTA TCAGTTCAGGAATGGAATTCCTCTTACCACGCCTGCTGCAGCCAACTTTACTCGAGGGGAGCTGGCTACTGCTTTGAGAAAGAATCCTTATCAAGTTAAC CTCTTGATGGCTGGTTATGACAAAGACATAGGCCCATCTTTGTATTACATCGACTACATTGCTACCCTTCACAAGGTTGACAAGGGTGCATTCGGCTATG GCTCCTATTTCTGTCTTTCCATGATGGATCGACTGTACCACAGTGGCATGACTGTGGAGGAAGCTATTGATCTCGTAGACAAGTGCATAGCGGAGATCCG GTTGAGGTTGGTAGTGGCACCGCCAAATTTCGTCATTAAAATCGTCGACAAGGATGGGGCAAGGGAGTACGCCTGGCGCAAGTCTGTCAAGGATGATGAA GCAGCTTAA
AA sequence Show only first row Show all	>Lus10041194 pacid=23180022 polypeptide=Lus10041194 locus=Lus10041194.g ID=Lus10041194.BGIv1.0 annot-version=v1.0 MECVFGLVGNDFAIVAADTSAVHSILVHKSNEDKIMLLDSHKLVAASGEPGDRVQFTEYIQKNVTLYQFRNGIPLTTPAAANFTRGELATALRKNPYQVN LLMAGYDKDIGPSLYYIDYIATLHKVDKGAFGYGSYFCLSMMDRLYHSGMTVEEAIDLVDKCIAEIRLRLVVAPPNFVIKIVDKDGAREYAWRKSVKDDE AA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10041194 [exp]	0	1
AT1G11240			unknown protein		Lus10011247 [exp]	1.4	0.9461
AT1G05205			unknown protein		Lus10039669 [exp]	1.7	0.9302
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Lus10015667 [exp]	2.0	0.9323
AT3G05070			unknown protein		Lus10026367 [exp]	2.2	0.9189
AT5G07960			unknown protein		Lus10021623 [exp]	2.8	0.9195
AT5G40580		PBB2	20S proteasome beta subunit PB...		Lus10014581 [exp]	3.9	0.8916
AT1G26340		B5 #6, B5#6, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10000651 [exp]	4.5	0.8804
AT2G19790			SNARE-like superfamily protein...		Lus10012924 [exp]	4.6	0.9055
AT3G17210		ATHS1	A. THALIANA HEAT STABLE PROTEI...		Lus10037823 [exp]	5.1	0.8737
AT5G07960			unknown protein		Lus10034695 [exp]	5.8	0.8848

Compare expression of checked genes

Lus10041194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.