Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05450 96 / 2e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22620 88 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48140 70 / 2e-15 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48130 59 / 5e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 57 / 2e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 53 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 47 / 4e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G03103 46 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 46 / 4e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 44 / 1e-05 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021911 [exp] 184 / 4e-59 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010575 [exp] 117 / 6e-33 AT1G05450 142 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014683 [exp] 76 / 4e-16 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10006906 [exp] 72 / 4e-16 AT2G48140 119 / 1e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042613 [exp] 72 / 1e-15 AT2G48140 107 / 1e-29 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10022067 [exp] 70 / 1e-14 AT2G48140 122 / 2e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010572 [exp] 59 / 5e-11 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 59 / 6e-11 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10026220 [exp] 56 / 2e-09 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085200 [exp] 108 / 3e-29 AT1G05450 134 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155200 [exp] 106 / 2e-28 AT2G48140 121 / 2e-34 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G212000 [exp] 89 / 6e-22 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050200 [exp] 79 / 4e-18 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 55 / 1e-09 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 54 / 4e-09 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 52 / 2e-08 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 51 / 4e-08 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232000 [exp] 47 / 1e-06 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 46 / 3e-06 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10041196 pacid=23179828 polypeptide=Lus10041196 locus=Lus10041196.g ID=Lus10041196.BGIv1.0 annot-version=v1.0 ATGGCTCTGCTTCTTCTTTCCATGGCTGCTTCATTAATGGTGTTGCTTGTTTCGGGCCAGACCATAACCCCAACCCCAACCACCCCAGCTTGCTCTGCAT CAGCAATTGCTGGACTCAGCCCTTGCATGAGTTTCCTCACTAACAATGGCACCACCCCACCTGCAGACTGCTGCAGTTCCCTTAAGAACCTCACTTCCAC CAGCACAGACTGCCTTTGCCTTGCCATCACTGGAGCTCTACCTTTCCAGATTCCCATCAACAGAACCTTGGCCATCTCTCTCCCTCGCGCTTGCAACATG CCCGGTGTCCCTCTCCAATGCAAAGCTGCTACAGGTGCTCCAGCTCCTGCTCCAGGCCCAGCAGCACCACTAGCACCATCTCTAGCTCCAGGAGTTTCTC AGTCAGATACCCCTGCAAGTTCTGCTGTTCCTGAGACACCTTCAGATGGTACAACTCCAACAACTCCAGCTTTGGATCCAACATCAACTGCTACTGGAAG CAACCCAACCACTAACACTTCAGCAGCAGCAGCCTCTTACAGCTTTTCTCCATGTCTAATACTGTTTCTACTGGGATTGATGATCTGCAATTTCAACTAG
AA sequence Show only first row Show all	>Lus10041196 pacid=23179828 polypeptide=Lus10041196 locus=Lus10041196.g ID=Lus10041196.BGIv1.0 annot-version=v1.0 MALLLLSMAASLMVLLVSGQTITPTPTTPACSASAIAGLSPCMSFLTNNGTTPPADCCSSLKNLTSTSTDCLCLAITGALPFQIPINRTLAISLPRACNM PGVPLQCKAATGAPAPAPGPAAPLAPSLAPGVSQSDTPASSAVPETPSDGTTPTTPALDPTSTATGSNPTTNTSAAAASYSFSPCLILFLLGLMICNFN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10041196 [exp]	0	1
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10032554 [exp]	1.0	0.9865
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022066 [exp]	2.4	0.9782
					Lus10003161 [exp]	2.8	0.9577
AT4G24130			Protein of unknown function, D...		Lus10017330 [exp]	3.9	0.9675
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10021911 [exp]	4.5	0.9657
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10014681 [exp]	6.0	0.9579
AT1G61240			Protein of unknown function (D...		Lus10018456 [exp]	7.7	0.9058
AT4G16640			Matrixin family protein (.1)		Lus10028955 [exp]	7.7	0.9449
AT4G02830			unknown protein		Lus10042573 [exp]	8.4	0.9578
AT5G07475			Cupredoxin superfamily protein...		Lus10012085 [exp]	8.4	0.9607

Compare expression of checked genes

Lus10041196 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.